Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9YVC6

Protein Details
Accession A0A4P9YVC6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-23NPSIQSLKKTLRKQLRSRLKLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 2.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002698  FTHF_cligase  
IPR024185  FTHF_cligase-like_sf  
IPR037171  NagB/RpiA_transferase-like  
Pfam View protein in Pfam  
PF01812  5-FTHF_cyc-lig  
Amino Acid Sequences MNPSIQSLKKTLRKQLRSRLKLVSPATVAAECNIFISMDGEIETRPIIEDILATGRSCYIPRWQHDTMEMVRLTSLEDFKALPLNAWNIPEPRHDEPRENGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.83
4 0.8
5 0.79
6 0.76
7 0.69
8 0.67
9 0.6
10 0.53
11 0.43
12 0.38
13 0.35
14 0.28
15 0.24
16 0.16
17 0.15
18 0.1
19 0.09
20 0.08
21 0.06
22 0.06
23 0.06
24 0.06
25 0.05
26 0.06
27 0.05
28 0.05
29 0.05
30 0.05
31 0.04
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.07
44 0.07
45 0.08
46 0.15
47 0.2
48 0.23
49 0.31
50 0.32
51 0.32
52 0.33
53 0.36
54 0.29
55 0.29
56 0.26
57 0.19
58 0.17
59 0.16
60 0.16
61 0.14
62 0.13
63 0.08
64 0.09
65 0.09
66 0.1
67 0.15
68 0.14
69 0.12
70 0.14
71 0.17
72 0.18
73 0.2
74 0.23
75 0.2
76 0.22
77 0.26
78 0.31
79 0.34
80 0.41
81 0.43
82 0.46