Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9YXX0

Protein Details
Accession A0A4P9YXX0    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-29LWEGCQYRCKSKKRHHMNSHLRSHVPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 13.166, nucl 4.5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences VACLWEGCQYRCKSKKRHHMNSHLRSHVPLSPFQCHICAVTFKWKSDLTKHLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.76
3 0.79
4 0.87
5 0.86
6 0.89
7 0.91
8 0.9
9 0.88
10 0.8
11 0.7
12 0.59
13 0.51
14 0.43
15 0.34
16 0.28
17 0.24
18 0.23
19 0.25
20 0.25
21 0.24
22 0.21
23 0.2
24 0.19
25 0.18
26 0.17
27 0.26
28 0.28
29 0.28
30 0.32
31 0.35
32 0.36
33 0.4