Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9Z0V5

Protein Details
Accession A0A4P9Z0V5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26KVLITHQRAKHFKCPQCNKKMNTVGGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
CDD cd20908  SUF4-like  
Amino Acid Sequences KVLITHQRAKHFKCPQCNKKMNTVGGLVIHYTQVHKETLRSTPNAIKGRDSVDVEIFGMEGIPAADLISFQMRKAAAGEPNVLEQLQFQQQQQQQSLYKRPRIHTDLNQPLSPEELREQLARHQASL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.83
4 0.86
5 0.8
6 0.8
7 0.81
8 0.72
9 0.64
10 0.55
11 0.46
12 0.38
13 0.35
14 0.25
15 0.17
16 0.14
17 0.11
18 0.11
19 0.1
20 0.11
21 0.12
22 0.12
23 0.13
24 0.15
25 0.21
26 0.24
27 0.24
28 0.26
29 0.29
30 0.37
31 0.41
32 0.39
33 0.35
34 0.32
35 0.34
36 0.33
37 0.3
38 0.22
39 0.17
40 0.17
41 0.15
42 0.13
43 0.1
44 0.07
45 0.05
46 0.04
47 0.03
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.03
55 0.06
56 0.06
57 0.06
58 0.09
59 0.09
60 0.09
61 0.11
62 0.13
63 0.13
64 0.15
65 0.16
66 0.14
67 0.15
68 0.16
69 0.14
70 0.11
71 0.09
72 0.1
73 0.13
74 0.14
75 0.14
76 0.21
77 0.25
78 0.29
79 0.31
80 0.33
81 0.33
82 0.37
83 0.47
84 0.47
85 0.52
86 0.53
87 0.55
88 0.59
89 0.61
90 0.63
91 0.63
92 0.66
93 0.69
94 0.67
95 0.65
96 0.57
97 0.5
98 0.46
99 0.37
100 0.29
101 0.21
102 0.19
103 0.21
104 0.22
105 0.23
106 0.26
107 0.35