Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VNM0

Protein Details
Accession K1VNM0    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
80-100GHSCYRPRRSGERKRKSVRGCBasic
179-207LVTPQRLQRKRHLRSLKKRRAEAQKEVKAHydrophilic
NLS Segment(s)
PositionSequence
87-95RRSGERKRK
184-201RLQRKRHLRSLKKRRAEA
Subcellular Location(s) cyto 13, nucl 7.5, mito_nucl 7, cyto_pero 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
IPR018282  Ribosomal_S6e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
PROSITE View protein in PROSITE  
PS00578  RIBOSOMAL_S6E  
Amino Acid Sequences MKLNVANPATGAQKSFEIEDERKARIFYDLRMSQEVAADNLGDEWKGYVLRITGGNDKQGFPMKQGVLLNHRTRLLLSDGHSCYRPRRSGERKRKSVRGCIVGSDIQALSVVVVKQGENDIPGLTDVVVPKRLGPKRATRIRRFFNLSKEDDVRQYVVRREVTTKAGKTYTKAPKIQRLVTPQRLQRKRHLRSLKKRRAEAQKEVKAEYDQALAKFHAEKSASKAAHKAAHSTKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.19
4 0.23
5 0.24
6 0.31
7 0.34
8 0.34
9 0.34
10 0.34
11 0.31
12 0.32
13 0.32
14 0.27
15 0.33
16 0.34
17 0.37
18 0.39
19 0.39
20 0.32
21 0.33
22 0.3
23 0.21
24 0.17
25 0.13
26 0.1
27 0.1
28 0.1
29 0.07
30 0.06
31 0.06
32 0.07
33 0.07
34 0.07
35 0.07
36 0.08
37 0.1
38 0.12
39 0.14
40 0.2
41 0.21
42 0.27
43 0.27
44 0.27
45 0.28
46 0.33
47 0.31
48 0.26
49 0.31
50 0.25
51 0.28
52 0.29
53 0.29
54 0.29
55 0.36
56 0.36
57 0.33
58 0.33
59 0.29
60 0.28
61 0.27
62 0.23
63 0.19
64 0.18
65 0.23
66 0.24
67 0.25
68 0.27
69 0.26
70 0.28
71 0.33
72 0.35
73 0.32
74 0.41
75 0.5
76 0.6
77 0.7
78 0.75
79 0.79
80 0.81
81 0.85
82 0.8
83 0.78
84 0.73
85 0.69
86 0.59
87 0.5
88 0.46
89 0.38
90 0.33
91 0.25
92 0.18
93 0.11
94 0.1
95 0.08
96 0.05
97 0.06
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.06
104 0.06
105 0.05
106 0.06
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.06
113 0.06
114 0.07
115 0.09
116 0.09
117 0.1
118 0.19
119 0.21
120 0.24
121 0.28
122 0.36
123 0.44
124 0.54
125 0.62
126 0.62
127 0.69
128 0.7
129 0.72
130 0.7
131 0.64
132 0.62
133 0.6
134 0.54
135 0.5
136 0.47
137 0.42
138 0.37
139 0.34
140 0.28
141 0.24
142 0.24
143 0.23
144 0.26
145 0.26
146 0.26
147 0.28
148 0.29
149 0.32
150 0.36
151 0.34
152 0.32
153 0.34
154 0.33
155 0.32
156 0.39
157 0.43
158 0.44
159 0.5
160 0.52
161 0.57
162 0.62
163 0.65
164 0.62
165 0.61
166 0.64
167 0.66
168 0.68
169 0.65
170 0.7
171 0.72
172 0.71
173 0.72
174 0.73
175 0.7
176 0.74
177 0.78
178 0.78
179 0.82
180 0.89
181 0.89
182 0.87
183 0.87
184 0.86
185 0.86
186 0.83
187 0.83
188 0.82
189 0.8
190 0.74
191 0.69
192 0.62
193 0.52
194 0.46
195 0.37
196 0.3
197 0.25
198 0.23
199 0.24
200 0.22
201 0.22
202 0.23
203 0.22
204 0.23
205 0.22
206 0.23
207 0.28
208 0.37
209 0.37
210 0.36
211 0.4
212 0.4
213 0.44
214 0.44
215 0.45