Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9YWZ4

Protein Details
Accession A0A4P9YWZ4   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
95-118GPTRREHPGKPGSRRRQRYDNSHFBasic
NLS Segment(s)
PositionSequence
81-110EKARRQTWKPAPHDGPTRREHPGKPGSRRR
Subcellular Location(s) nucl 8, cyto 7, cysk 7, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036867  R3H_dom_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MAITPLSTPAAASPDVDSRAAAATMAQALSLDYGPTTPAHGMTVRLMTFHGHQHPAYMASGSQRQAANERRDPSTAATTKEKARRQTWKPAPHDGPTRREHPGKPGSRRRQRYDNSHFVGHPWAILSPEDLPAPGYPHDAPGFHFTEHAQLAMTAPDASPIHGRYEPRSRPAARHGLTPGDRALRQAVRRRQVPRGLVRRVEATIRRFLSGEDTRSEAWMLLEEEDVAEQREEQEGVVSDVDESMVLVCEADVREQWAEEHEEEPLTVTSKRRLVWRGSDGLSRLVVHSVCRHYRLHSYSKDARDGARLTYIERRPETTMPVGTTSFYDALFASTIEHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.2
4 0.19
5 0.16
6 0.18
7 0.17
8 0.14
9 0.1
10 0.09
11 0.1
12 0.1
13 0.09
14 0.07
15 0.07
16 0.09
17 0.09
18 0.07
19 0.06
20 0.06
21 0.08
22 0.08
23 0.1
24 0.09
25 0.1
26 0.12
27 0.13
28 0.14
29 0.16
30 0.2
31 0.17
32 0.17
33 0.17
34 0.17
35 0.18
36 0.23
37 0.25
38 0.25
39 0.25
40 0.26
41 0.27
42 0.27
43 0.25
44 0.19
45 0.15
46 0.15
47 0.2
48 0.19
49 0.22
50 0.21
51 0.22
52 0.29
53 0.37
54 0.41
55 0.43
56 0.46
57 0.44
58 0.44
59 0.45
60 0.41
61 0.42
62 0.37
63 0.34
64 0.36
65 0.37
66 0.43
67 0.5
68 0.52
69 0.5
70 0.55
71 0.61
72 0.62
73 0.7
74 0.72
75 0.74
76 0.73
77 0.76
78 0.72
79 0.68
80 0.72
81 0.67
82 0.64
83 0.58
84 0.57
85 0.53
86 0.54
87 0.49
88 0.49
89 0.53
90 0.54
91 0.6
92 0.67
93 0.72
94 0.77
95 0.84
96 0.82
97 0.82
98 0.8
99 0.81
100 0.79
101 0.78
102 0.71
103 0.65
104 0.58
105 0.49
106 0.45
107 0.34
108 0.25
109 0.16
110 0.12
111 0.1
112 0.1
113 0.1
114 0.08
115 0.09
116 0.08
117 0.08
118 0.09
119 0.08
120 0.1
121 0.09
122 0.11
123 0.1
124 0.13
125 0.13
126 0.13
127 0.14
128 0.17
129 0.18
130 0.15
131 0.16
132 0.14
133 0.17
134 0.16
135 0.15
136 0.1
137 0.08
138 0.08
139 0.08
140 0.08
141 0.05
142 0.04
143 0.07
144 0.07
145 0.07
146 0.09
147 0.09
148 0.12
149 0.14
150 0.15
151 0.17
152 0.27
153 0.28
154 0.3
155 0.36
156 0.34
157 0.35
158 0.4
159 0.45
160 0.37
161 0.38
162 0.35
163 0.35
164 0.34
165 0.33
166 0.28
167 0.21
168 0.21
169 0.18
170 0.21
171 0.19
172 0.23
173 0.31
174 0.36
175 0.4
176 0.46
177 0.49
178 0.53
179 0.55
180 0.57
181 0.57
182 0.59
183 0.58
184 0.53
185 0.51
186 0.46
187 0.41
188 0.39
189 0.34
190 0.29
191 0.31
192 0.29
193 0.29
194 0.27
195 0.26
196 0.29
197 0.27
198 0.26
199 0.21
200 0.22
201 0.21
202 0.22
203 0.22
204 0.14
205 0.11
206 0.1
207 0.1
208 0.08
209 0.08
210 0.07
211 0.07
212 0.07
213 0.07
214 0.06
215 0.06
216 0.05
217 0.06
218 0.07
219 0.07
220 0.07
221 0.08
222 0.08
223 0.09
224 0.09
225 0.08
226 0.07
227 0.07
228 0.07
229 0.05
230 0.05
231 0.04
232 0.04
233 0.04
234 0.03
235 0.03
236 0.05
237 0.06
238 0.07
239 0.07
240 0.09
241 0.09
242 0.1
243 0.1
244 0.11
245 0.14
246 0.15
247 0.15
248 0.14
249 0.13
250 0.13
251 0.15
252 0.13
253 0.11
254 0.12
255 0.14
256 0.19
257 0.23
258 0.25
259 0.3
260 0.35
261 0.38
262 0.44
263 0.48
264 0.49
265 0.47
266 0.49
267 0.44
268 0.41
269 0.36
270 0.29
271 0.23
272 0.2
273 0.18
274 0.17
275 0.21
276 0.26
277 0.29
278 0.32
279 0.32
280 0.33
281 0.42
282 0.46
283 0.49
284 0.47
285 0.52
286 0.57
287 0.61
288 0.63
289 0.56
290 0.51
291 0.49
292 0.46
293 0.39
294 0.37
295 0.32
296 0.3
297 0.37
298 0.4
299 0.42
300 0.43
301 0.44
302 0.43
303 0.45
304 0.47
305 0.43
306 0.42
307 0.36
308 0.37
309 0.34
310 0.29
311 0.28
312 0.26
313 0.21
314 0.17
315 0.16
316 0.13
317 0.14
318 0.14
319 0.13