Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9YTB5

Protein Details
Accession A0A4P9YTB5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
94-125PKSSEIIKIKFKKRKNYHRRLRYRHHYTLLRIBasic
NLS Segment(s)
PositionSequence
101-114KIKFKKRKNYHRRL
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cysk 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
IPR001787  Ribosomal_L21  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences MSSSSSSLPADIQEAAQLLREQKNHYAVIEIMGRSFLVTKNDIVVVDHLRHAQVGDILEFDRIREIGSMDYTLYGKPVVDPRMVRVRATVIEEPKSSEIIKIKFKKRKNYHRRLRYRHHYTLLRISEVEMLPAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.12
4 0.13
5 0.15
6 0.19
7 0.22
8 0.24
9 0.29
10 0.33
11 0.32
12 0.31
13 0.29
14 0.24
15 0.24
16 0.24
17 0.19
18 0.14
19 0.14
20 0.13
21 0.11
22 0.12
23 0.11
24 0.1
25 0.12
26 0.12
27 0.13
28 0.14
29 0.14
30 0.13
31 0.14
32 0.13
33 0.13
34 0.14
35 0.13
36 0.12
37 0.12
38 0.11
39 0.09
40 0.08
41 0.08
42 0.07
43 0.07
44 0.07
45 0.08
46 0.08
47 0.08
48 0.07
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.07
56 0.06
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.05
63 0.06
64 0.11
65 0.12
66 0.15
67 0.15
68 0.19
69 0.28
70 0.29
71 0.28
72 0.25
73 0.25
74 0.23
75 0.28
76 0.28
77 0.22
78 0.25
79 0.25
80 0.27
81 0.25
82 0.25
83 0.2
84 0.2
85 0.22
86 0.24
87 0.33
88 0.4
89 0.49
90 0.56
91 0.63
92 0.71
93 0.76
94 0.83
95 0.84
96 0.87
97 0.88
98 0.91
99 0.95
100 0.93
101 0.94
102 0.93
103 0.91
104 0.89
105 0.87
106 0.82
107 0.77
108 0.77
109 0.7
110 0.61
111 0.52
112 0.44
113 0.42
114 0.35