Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Z4P2

Protein Details
Accession A0A4P9Z4P2    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-42ASKAPAKGVDKSKKNRRLKRRETYASYIYHydrophilic
NLS Segment(s)
PositionSequence
5-34PAEKKPATTASKAPAKGVDKSKKNRRLKRR
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MPPKPAEKKPATTASKAPAKGVDKSKKNRRLKRRETYASYIYKVLKQVHPDTGISNKAMSIMNSFVNDIFERIAAEASKLASYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.54
4 0.48
5 0.45
6 0.43
7 0.45
8 0.51
9 0.52
10 0.54
11 0.64
12 0.73
13 0.76
14 0.83
15 0.86
16 0.88
17 0.89
18 0.91
19 0.91
20 0.91
21 0.89
22 0.86
23 0.83
24 0.79
25 0.72
26 0.63
27 0.55
28 0.46
29 0.39
30 0.36
31 0.33
32 0.28
33 0.29
34 0.3
35 0.31
36 0.31
37 0.29
38 0.27
39 0.26
40 0.24
41 0.2
42 0.17
43 0.13
44 0.12
45 0.12
46 0.11
47 0.09
48 0.09
49 0.09
50 0.09
51 0.1
52 0.08
53 0.09
54 0.09
55 0.08
56 0.07
57 0.06
58 0.06
59 0.06
60 0.07
61 0.05
62 0.06
63 0.06
64 0.06
65 0.07
66 0.07
67 0.08
68 0.13
69 0.17
70 0.21
71 0.25
72 0.27
73 0.28
74 0.31
75 0.37
76 0.38
77 0.39
78 0.37
79 0.36
80 0.34
81 0.33
82 0.32
83 0.27
84 0.22
85 0.17
86 0.15
87 0.12
88 0.12
89 0.12
90 0.1
91 0.09
92 0.1
93 0.1
94 0.1
95 0.1
96 0.09
97 0.1
98 0.1
99 0.11
100 0.12
101 0.14
102 0.16
103 0.16
104 0.18
105 0.17