Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Z6D2

Protein Details
Accession A0A4P9Z6D2    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-47LDDEEKPKKVSKKAKSRKKPPQNLDPNRPKRATBasic
NLS Segment(s)
PositionSequence
20-45KPKKVSKKAKSRKKPPQNLDPNRPKR
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019835  SWIB_domain  
IPR036885  SWIB_MDM2_dom_sf  
IPR003121  SWIB_MDM2_domain  
Pfam View protein in Pfam  
PF02201  SWIB  
PROSITE View protein in PROSITE  
PS51925  SWIB_MDM2  
CDD cd10567  SWIB-MDM2_like  
Amino Acid Sequences MNVGARRPLSGHHLLDDEEKPKKVSKKAKSRKKPPQNLDPNRPKRATPLTKPMRLSPDLMAVVGVAELGRAQVVKAIWGYIRQYNLQDPNDKRYFTTDDKLRAIFNGLERLNCFEMNKYLSAHLSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.34
4 0.32
5 0.29
6 0.29
7 0.29
8 0.34
9 0.39
10 0.44
11 0.51
12 0.56
13 0.63
14 0.72
15 0.82
16 0.86
17 0.91
18 0.93
19 0.94
20 0.94
21 0.91
22 0.91
23 0.91
24 0.89
25 0.89
26 0.89
27 0.86
28 0.83
29 0.76
30 0.65
31 0.6
32 0.61
33 0.59
34 0.54
35 0.56
36 0.56
37 0.6
38 0.61
39 0.58
40 0.53
41 0.46
42 0.42
43 0.32
44 0.28
45 0.23
46 0.21
47 0.18
48 0.12
49 0.1
50 0.08
51 0.07
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.04
60 0.05
61 0.06
62 0.06
63 0.07
64 0.07
65 0.09
66 0.11
67 0.12
68 0.14
69 0.14
70 0.16
71 0.21
72 0.27
73 0.28
74 0.34
75 0.34
76 0.41
77 0.43
78 0.42
79 0.37
80 0.36
81 0.39
82 0.36
83 0.42
84 0.39
85 0.41
86 0.44
87 0.44
88 0.4
89 0.34
90 0.33
91 0.27
92 0.24
93 0.26
94 0.24
95 0.25
96 0.26
97 0.3
98 0.29
99 0.28
100 0.26
101 0.21
102 0.25
103 0.26
104 0.27
105 0.24
106 0.24