Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9Z412

Protein Details
Accession A0A4P9Z412    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-39ILRAVPKKKTSHSKKRMRSSNKGLKNRTHydrophilic
NLS Segment(s)
PositionSequence
17-34PKKKTSHSKKRMRSSNKG
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MLEGLRELWESILRAVPKKKTSHSKKRMRSSNKGLKNRTDIVACPGCGRDRMMGHVCRHCLRDIKHRLKHGENTTATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.34
4 0.39
5 0.43
6 0.49
7 0.56
8 0.64
9 0.7
10 0.75
11 0.79
12 0.82
13 0.88
14 0.9
15 0.87
16 0.86
17 0.86
18 0.85
19 0.84
20 0.83
21 0.77
22 0.71
23 0.67
24 0.6
25 0.51
26 0.42
27 0.32
28 0.29
29 0.28
30 0.23
31 0.19
32 0.18
33 0.17
34 0.17
35 0.18
36 0.15
37 0.14
38 0.19
39 0.24
40 0.29
41 0.33
42 0.37
43 0.4
44 0.39
45 0.4
46 0.38
47 0.39
48 0.38
49 0.44
50 0.51
51 0.57
52 0.62
53 0.68
54 0.72
55 0.72
56 0.77
57 0.73
58 0.72