Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9YTQ3

Protein Details
Accession A0A4P9YTQ3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
91-111GTAKRWRRTGPQRTGNWKRGQHydrophilic
NLS Segment(s)
PositionSequence
80-115RRGVKKLKTHKGTAKRWRRTGPQRTGNWKRGQVGKR
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR021137  Ribosomal_L35  
IPR001706  Ribosomal_L35_non-mt  
IPR037229  Ribosomal_L35_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01632  Ribosomal_L35p  
Amino Acid Sequences MWLPNLYRQAGTLAGANIMRGLPTGWLPRSPRFLSLLSSSAATTSPLMASFRERATAIGPMAGGRLWGMERASALSMEQRRGVKKLKTHKGTAKRWRRTGPQRTGNWKRGQVGKRHLNHGMGATRIRTLRGTVHATKTQSTLLRRLLPFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.12
5 0.11
6 0.1
7 0.08
8 0.08
9 0.07
10 0.1
11 0.15
12 0.16
13 0.22
14 0.26
15 0.3
16 0.37
17 0.37
18 0.37
19 0.35
20 0.34
21 0.33
22 0.32
23 0.29
24 0.22
25 0.21
26 0.18
27 0.15
28 0.14
29 0.12
30 0.09
31 0.07
32 0.07
33 0.07
34 0.08
35 0.08
36 0.11
37 0.12
38 0.12
39 0.14
40 0.13
41 0.13
42 0.14
43 0.16
44 0.13
45 0.11
46 0.1
47 0.09
48 0.09
49 0.08
50 0.06
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.05
57 0.05
58 0.06
59 0.06
60 0.06
61 0.06
62 0.09
63 0.11
64 0.12
65 0.15
66 0.17
67 0.18
68 0.21
69 0.27
70 0.26
71 0.32
72 0.42
73 0.48
74 0.51
75 0.56
76 0.61
77 0.66
78 0.72
79 0.76
80 0.76
81 0.75
82 0.77
83 0.76
84 0.78
85 0.78
86 0.79
87 0.78
88 0.77
89 0.76
90 0.8
91 0.83
92 0.81
93 0.77
94 0.7
95 0.65
96 0.64
97 0.63
98 0.61
99 0.62
100 0.63
101 0.61
102 0.62
103 0.61
104 0.53
105 0.49
106 0.45
107 0.37
108 0.31
109 0.28
110 0.24
111 0.24
112 0.23
113 0.23
114 0.19
115 0.19
116 0.2
117 0.24
118 0.31
119 0.33
120 0.39
121 0.43
122 0.44
123 0.44
124 0.42
125 0.41
126 0.4
127 0.38
128 0.38
129 0.4
130 0.46