Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9YZN1

Protein Details
Accession A0A4P9YZN1    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
15-36FDPSKIPRLRRAKEAQHKVRLMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR007590  Saf4/Yju2  
IPR043701  Yju2  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0046872  F:metal ion binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF04502  Saf4_Yju2  
Amino Acid Sequences MSERKVLNKYYPPDFDPSKIPRLRRAKEAQHKVRLMAPFSMRCTTCAEYIAKGKKFNARKETVEGEDYLGIKIFRFYIRCPRCSVEITFKTDPENSDYTCEQGALRNFEPWREEKILGAEAEKHTETESKLDPMRALERRTEESKREMEILDALDEIRIRNARNERVDQEAVLEHVLGEDPEERARREEEELDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.46
3 0.46
4 0.46
5 0.49
6 0.5
7 0.5
8 0.54
9 0.61
10 0.62
11 0.63
12 0.67
13 0.68
14 0.74
15 0.82
16 0.81
17 0.8
18 0.78
19 0.7
20 0.66
21 0.59
22 0.5
23 0.44
24 0.4
25 0.34
26 0.36
27 0.39
28 0.34
29 0.32
30 0.35
31 0.32
32 0.28
33 0.27
34 0.25
35 0.23
36 0.3
37 0.37
38 0.34
39 0.34
40 0.36
41 0.41
42 0.47
43 0.53
44 0.54
45 0.51
46 0.52
47 0.54
48 0.56
49 0.5
50 0.44
51 0.36
52 0.28
53 0.25
54 0.22
55 0.17
56 0.13
57 0.1
58 0.09
59 0.09
60 0.09
61 0.09
62 0.1
63 0.12
64 0.23
65 0.27
66 0.29
67 0.32
68 0.33
69 0.34
70 0.35
71 0.36
72 0.35
73 0.34
74 0.4
75 0.37
76 0.35
77 0.34
78 0.32
79 0.3
80 0.24
81 0.22
82 0.15
83 0.17
84 0.17
85 0.16
86 0.15
87 0.15
88 0.11
89 0.12
90 0.14
91 0.15
92 0.16
93 0.19
94 0.19
95 0.2
96 0.22
97 0.2
98 0.24
99 0.23
100 0.23
101 0.19
102 0.21
103 0.22
104 0.2
105 0.19
106 0.16
107 0.13
108 0.16
109 0.15
110 0.13
111 0.12
112 0.14
113 0.14
114 0.15
115 0.16
116 0.16
117 0.18
118 0.18
119 0.18
120 0.19
121 0.25
122 0.26
123 0.27
124 0.27
125 0.3
126 0.35
127 0.4
128 0.41
129 0.38
130 0.39
131 0.4
132 0.38
133 0.35
134 0.3
135 0.26
136 0.23
137 0.21
138 0.16
139 0.13
140 0.11
141 0.1
142 0.1
143 0.09
144 0.11
145 0.13
146 0.13
147 0.21
148 0.28
149 0.35
150 0.41
151 0.46
152 0.44
153 0.5
154 0.5
155 0.42
156 0.37
157 0.3
158 0.25
159 0.2
160 0.17
161 0.1
162 0.09
163 0.09
164 0.07
165 0.07
166 0.08
167 0.09
168 0.15
169 0.17
170 0.19
171 0.21
172 0.24
173 0.26
174 0.29