Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9YWZ8

Protein Details
Accession A0A4P9YWZ8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-47REALKVTKTRKAERRRGRVQRSVFLHydrophilic
NLS Segment(s)
PositionSequence
30-40KTRKAERRRGR
Subcellular Location(s) nucl 12.5, cyto_nucl 9.833, mito_nucl 9.833, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013566  EF_hand_assoc_1  
IPR027417  P-loop_NTPase  
Pfam View protein in Pfam  
PF08355  EF_assoc_1  
Amino Acid Sequences MTLLDSRKTLGYLAYLGYHGDAREALKVTKTRKAERRRGRVQRSVFLCYVLGAAGSGKTSLLRAFVRRPVLPHYTPTTRVLSVVNTVEVKGSERYLVLQEVGSNFQEELLRDKRRLEMCDLLCFVYDRSDANSFEYRFDVPPDVYCRQLGLAPPLSVSVMTQPTTDIFNTLTDIAMHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.13
5 0.13
6 0.11
7 0.1
8 0.1
9 0.1
10 0.13
11 0.15
12 0.15
13 0.19
14 0.25
15 0.28
16 0.35
17 0.4
18 0.46
19 0.54
20 0.63
21 0.69
22 0.74
23 0.81
24 0.84
25 0.88
26 0.88
27 0.88
28 0.83
29 0.8
30 0.73
31 0.68
32 0.58
33 0.48
34 0.39
35 0.3
36 0.24
37 0.16
38 0.11
39 0.06
40 0.05
41 0.04
42 0.05
43 0.04
44 0.04
45 0.04
46 0.05
47 0.06
48 0.09
49 0.1
50 0.13
51 0.16
52 0.21
53 0.25
54 0.25
55 0.27
56 0.29
57 0.34
58 0.32
59 0.32
60 0.33
61 0.31
62 0.33
63 0.34
64 0.32
65 0.25
66 0.25
67 0.22
68 0.17
69 0.16
70 0.14
71 0.12
72 0.1
73 0.1
74 0.09
75 0.09
76 0.09
77 0.08
78 0.08
79 0.07
80 0.07
81 0.08
82 0.08
83 0.09
84 0.07
85 0.07
86 0.07
87 0.08
88 0.09
89 0.09
90 0.08
91 0.08
92 0.08
93 0.09
94 0.09
95 0.14
96 0.19
97 0.21
98 0.22
99 0.23
100 0.29
101 0.32
102 0.34
103 0.33
104 0.35
105 0.34
106 0.37
107 0.37
108 0.31
109 0.27
110 0.26
111 0.21
112 0.15
113 0.14
114 0.1
115 0.13
116 0.16
117 0.16
118 0.2
119 0.25
120 0.24
121 0.24
122 0.26
123 0.24
124 0.22
125 0.24
126 0.22
127 0.17
128 0.21
129 0.26
130 0.26
131 0.26
132 0.25
133 0.23
134 0.21
135 0.23
136 0.21
137 0.21
138 0.23
139 0.22
140 0.22
141 0.22
142 0.21
143 0.19
144 0.17
145 0.15
146 0.14
147 0.15
148 0.14
149 0.15
150 0.15
151 0.18
152 0.18
153 0.14
154 0.12
155 0.12
156 0.15
157 0.14
158 0.14