Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9Z5M3

Protein Details
Accession A0A4P9Z5M3    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-24GRQGGKLKPLKQAKKKTQDLDEHydrophilic
NLS Segment(s)
PositionSequence
34-64REEQKKLKELAARAAKGGPLGASGIKKSGKK
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MSGRQGGKLKPLKQAKKKTQDLDEEDLAFKQKQREEQKKLKELAARAAKGGPLGASGIKKSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.82
4 0.86
5 0.83
6 0.8
7 0.78
8 0.73
9 0.68
10 0.59
11 0.5
12 0.42
13 0.36
14 0.31
15 0.23
16 0.18
17 0.17
18 0.17
19 0.24
20 0.34
21 0.43
22 0.5
23 0.59
24 0.66
25 0.69
26 0.69
27 0.65
28 0.59
29 0.51
30 0.52
31 0.51
32 0.42
33 0.36
34 0.35
35 0.31
36 0.27
37 0.25
38 0.16
39 0.09
40 0.09
41 0.11
42 0.12
43 0.13
44 0.17