Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VS54

Protein Details
Accession K1VS54    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
164-183ASRASTPEAMPKRKRRWGVPHydrophilic
NLS Segment(s)
PositionSequence
81-139PRKAPAPKARRGTMSKAKSSKDETPAAKNGKKRSSPLSSPAPTPKRSRKSAAVSAPKAT
175-179KRKRR
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MGNEDAPSPSRSSSSPSPPPDRSEATPPPASPSPVSSLPSPAPPTISHFARPKGKLVTYSRRPRPVQMREDSPLSTPEATPRKAPAPKARRGTMSKAKSSKDETPAAKNGKKRSSPLSSPAPTPKRSRKSAAVSAPKATPRGKDDGDSPLSSPAPSDSEPESDASRASTPEAMPKRKRRWGVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.43
3 0.48
4 0.55
5 0.57
6 0.61
7 0.6
8 0.58
9 0.53
10 0.52
11 0.51
12 0.5
13 0.5
14 0.45
15 0.46
16 0.43
17 0.42
18 0.34
19 0.31
20 0.29
21 0.28
22 0.3
23 0.25
24 0.26
25 0.25
26 0.28
27 0.28
28 0.24
29 0.23
30 0.21
31 0.27
32 0.29
33 0.29
34 0.31
35 0.32
36 0.38
37 0.44
38 0.45
39 0.43
40 0.42
41 0.42
42 0.43
43 0.47
44 0.51
45 0.53
46 0.61
47 0.64
48 0.68
49 0.68
50 0.68
51 0.7
52 0.69
53 0.67
54 0.62
55 0.6
56 0.54
57 0.55
58 0.48
59 0.39
60 0.31
61 0.24
62 0.2
63 0.15
64 0.19
65 0.21
66 0.21
67 0.22
68 0.23
69 0.27
70 0.29
71 0.34
72 0.38
73 0.41
74 0.47
75 0.52
76 0.52
77 0.51
78 0.52
79 0.54
80 0.54
81 0.51
82 0.5
83 0.49
84 0.48
85 0.46
86 0.47
87 0.45
88 0.4
89 0.41
90 0.37
91 0.37
92 0.43
93 0.46
94 0.44
95 0.44
96 0.46
97 0.48
98 0.48
99 0.46
100 0.47
101 0.48
102 0.48
103 0.49
104 0.51
105 0.45
106 0.46
107 0.52
108 0.5
109 0.47
110 0.52
111 0.56
112 0.55
113 0.58
114 0.6
115 0.59
116 0.62
117 0.66
118 0.67
119 0.67
120 0.62
121 0.6
122 0.57
123 0.51
124 0.48
125 0.41
126 0.36
127 0.3
128 0.34
129 0.32
130 0.31
131 0.31
132 0.34
133 0.37
134 0.33
135 0.3
136 0.28
137 0.27
138 0.25
139 0.22
140 0.17
141 0.17
142 0.16
143 0.19
144 0.17
145 0.19
146 0.2
147 0.22
148 0.22
149 0.18
150 0.18
151 0.17
152 0.16
153 0.15
154 0.16
155 0.17
156 0.16
157 0.25
158 0.34
159 0.41
160 0.5
161 0.6
162 0.67
163 0.74