Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KS85

Protein Details
Accession A0A3N4KS85    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MRKKKYIRRRRRGPPGIPFRFSBasic
NLS Segment(s)
PositionSequence
2-15RKKKYIRRRRRGPP
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
Amino Acid Sequences MRKKKYIRRRRRGPPGIPFRFSLPGGVLVYVTLRYGTRNWKNYNICSHGEIDLNIYSARARSGRSGASGGRRQQAKWKRNIIPGDWKLLGGLDGWLSERLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.88
4 0.79
5 0.7
6 0.62
7 0.55
8 0.46
9 0.37
10 0.26
11 0.23
12 0.2
13 0.19
14 0.15
15 0.11
16 0.11
17 0.1
18 0.09
19 0.06
20 0.05
21 0.07
22 0.09
23 0.19
24 0.26
25 0.33
26 0.36
27 0.44
28 0.48
29 0.51
30 0.55
31 0.49
32 0.43
33 0.38
34 0.36
35 0.28
36 0.25
37 0.21
38 0.16
39 0.12
40 0.11
41 0.09
42 0.08
43 0.07
44 0.06
45 0.08
46 0.07
47 0.08
48 0.09
49 0.12
50 0.13
51 0.14
52 0.16
53 0.17
54 0.24
55 0.29
56 0.3
57 0.34
58 0.35
59 0.34
60 0.42
61 0.5
62 0.51
63 0.55
64 0.61
65 0.61
66 0.68
67 0.71
68 0.67
69 0.68
70 0.62
71 0.59
72 0.5
73 0.43
74 0.36
75 0.31
76 0.26
77 0.15
78 0.14
79 0.07
80 0.07
81 0.09