Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KWC6

Protein Details
Accession A0A3N4KWC6    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
114-136DAAAARKRAGRPRKKKGEDVTAVHydrophilic
NLS Segment(s)
PositionSequence
117-130AARKRAGRPRKKKG
Subcellular Location(s) nucl 13, cyto 8.5, cyto_mito 7.5, mito 5.5
Family & Domain DBs
Amino Acid Sequences MHTQSPSNHPKPVVLQLAKTYNIPESTLRRHIKTPGHRSTAEANRQKQLFTPEEEQSLVARALQGPGVDRSKCYELAHEILHKREPGKKVGKDWFYRFLKRHPECGYSSGRDGDAAAARKRAGRPRKKKGEDVTAVAAATAATAPLMATAASAEKMPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.41
3 0.41
4 0.45
5 0.43
6 0.39
7 0.33
8 0.27
9 0.25
10 0.25
11 0.24
12 0.26
13 0.31
14 0.4
15 0.43
16 0.42
17 0.44
18 0.49
19 0.54
20 0.58
21 0.62
22 0.61
23 0.62
24 0.6
25 0.6
26 0.61
27 0.61
28 0.6
29 0.58
30 0.53
31 0.53
32 0.53
33 0.5
34 0.44
35 0.41
36 0.34
37 0.31
38 0.32
39 0.28
40 0.29
41 0.29
42 0.27
43 0.2
44 0.19
45 0.14
46 0.1
47 0.09
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.1
54 0.13
55 0.13
56 0.13
57 0.16
58 0.17
59 0.19
60 0.18
61 0.16
62 0.16
63 0.18
64 0.19
65 0.2
66 0.19
67 0.19
68 0.2
69 0.2
70 0.19
71 0.23
72 0.24
73 0.28
74 0.35
75 0.36
76 0.41
77 0.48
78 0.52
79 0.52
80 0.54
81 0.55
82 0.52
83 0.55
84 0.51
85 0.5
86 0.54
87 0.51
88 0.55
89 0.5
90 0.49
91 0.45
92 0.48
93 0.46
94 0.38
95 0.37
96 0.31
97 0.27
98 0.22
99 0.2
100 0.18
101 0.17
102 0.19
103 0.18
104 0.19
105 0.2
106 0.24
107 0.28
108 0.36
109 0.42
110 0.49
111 0.59
112 0.68
113 0.79
114 0.81
115 0.86
116 0.84
117 0.84
118 0.78
119 0.72
120 0.65
121 0.55
122 0.48
123 0.39
124 0.31
125 0.19
126 0.14
127 0.09
128 0.05
129 0.03
130 0.03
131 0.03
132 0.03
133 0.04
134 0.04
135 0.04
136 0.05
137 0.06
138 0.07