Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KX14

Protein Details
Accession A0A3N4KX14    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
95-126GDATKIEKASRQQRKQRKNKAKEVRGTHGKKVBasic
NLS Segment(s)
PositionSequence
102-131KASRQQRKQRKNKAKEVRGTHGKKVSKDKK
Subcellular Location(s) mito 16, cyto 6, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADPVTLRTRKFLRNALLGRKQMVVDVLHPNRPNVSKDELRSKLAELYKADKSQVSVFGFRTQFGGGKSTGFALIYDSHDALKKFEPHYRLVRYGDATKIEKASRQQRKQRKNKAKEVRGTHGKKVSKDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.63
4 0.66
5 0.62
6 0.58
7 0.52
8 0.45
9 0.36
10 0.33
11 0.24
12 0.19
13 0.26
14 0.27
15 0.31
16 0.32
17 0.32
18 0.33
19 0.35
20 0.33
21 0.28
22 0.32
23 0.31
24 0.34
25 0.43
26 0.42
27 0.42
28 0.41
29 0.38
30 0.37
31 0.34
32 0.33
33 0.26
34 0.27
35 0.29
36 0.29
37 0.28
38 0.22
39 0.22
40 0.2
41 0.23
42 0.21
43 0.19
44 0.19
45 0.24
46 0.23
47 0.22
48 0.21
49 0.16
50 0.16
51 0.14
52 0.15
53 0.1
54 0.1
55 0.1
56 0.09
57 0.09
58 0.07
59 0.07
60 0.06
61 0.07
62 0.09
63 0.1
64 0.1
65 0.1
66 0.12
67 0.13
68 0.13
69 0.16
70 0.18
71 0.2
72 0.24
73 0.27
74 0.29
75 0.37
76 0.39
77 0.4
78 0.38
79 0.39
80 0.38
81 0.37
82 0.35
83 0.33
84 0.3
85 0.28
86 0.29
87 0.27
88 0.27
89 0.32
90 0.4
91 0.46
92 0.54
93 0.62
94 0.7
95 0.8
96 0.88
97 0.91
98 0.92
99 0.91
100 0.92
101 0.93
102 0.92
103 0.91
104 0.88
105 0.86
106 0.86
107 0.81
108 0.79
109 0.76
110 0.72
111 0.7