Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KNS1

Protein Details
Accession A0A3N4KNS1    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
68-93APTARSRSRRGGRRNRRGKKPQLTAVHydrophilic
NLS Segment(s)
PositionSequence
72-88RSRSRRGGRRNRRGKKP
Subcellular Location(s) nucl 19.5, cyto_nucl 14.333, cyto 6, cyto_pero 3.999
Family & Domain DBs
Amino Acid Sequences MSTAEATKPNEFNPEAQSSSREHSRQREEQSDHENDNNNNNEGAPNSPNNSGRSQSSGDHSDNDSDAAPTARSRSRRGGRRNRRGKKPQLTAVSESETDGKELQQRNQREEQMQRQYQQQQMQMQQMQQQMQMQQESGGKRDKPLRLRLDLNLELDVELKAKIHGDLELALLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.31
4 0.32
5 0.29
6 0.33
7 0.38
8 0.36
9 0.37
10 0.44
11 0.51
12 0.57
13 0.61
14 0.65
15 0.61
16 0.64
17 0.65
18 0.61
19 0.56
20 0.51
21 0.49
22 0.42
23 0.45
24 0.42
25 0.35
26 0.3
27 0.27
28 0.24
29 0.2
30 0.21
31 0.17
32 0.16
33 0.17
34 0.21
35 0.24
36 0.26
37 0.27
38 0.26
39 0.24
40 0.26
41 0.26
42 0.23
43 0.25
44 0.26
45 0.25
46 0.25
47 0.25
48 0.22
49 0.2
50 0.19
51 0.15
52 0.11
53 0.1
54 0.09
55 0.08
56 0.07
57 0.1
58 0.13
59 0.16
60 0.2
61 0.29
62 0.36
63 0.45
64 0.55
65 0.64
66 0.71
67 0.79
68 0.86
69 0.86
70 0.88
71 0.89
72 0.89
73 0.87
74 0.82
75 0.79
76 0.74
77 0.69
78 0.61
79 0.54
80 0.45
81 0.36
82 0.3
83 0.24
84 0.17
85 0.15
86 0.11
87 0.1
88 0.14
89 0.16
90 0.22
91 0.28
92 0.3
93 0.35
94 0.4
95 0.42
96 0.41
97 0.45
98 0.49
99 0.51
100 0.52
101 0.48
102 0.49
103 0.51
104 0.52
105 0.5
106 0.46
107 0.42
108 0.42
109 0.46
110 0.42
111 0.38
112 0.38
113 0.37
114 0.33
115 0.29
116 0.28
117 0.24
118 0.25
119 0.24
120 0.19
121 0.18
122 0.21
123 0.21
124 0.21
125 0.26
126 0.23
127 0.28
128 0.35
129 0.41
130 0.44
131 0.52
132 0.57
133 0.56
134 0.6
135 0.59
136 0.6
137 0.56
138 0.5
139 0.41
140 0.34
141 0.28
142 0.25
143 0.21
144 0.13
145 0.1
146 0.08
147 0.08
148 0.09
149 0.09
150 0.1
151 0.1
152 0.11
153 0.11