Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KMB1

Protein Details
Accession A0A3N4KMB1    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-33VRKGREGRKEKEREGKKLRKKKLRMVTPPGKVBasic
NLS Segment(s)
PositionSequence
3-26RKGREGRKEKEREGKKLRKKKLRM
Subcellular Location(s) mito 10, nucl 8, cyto 7
Family & Domain DBs
Amino Acid Sequences MVRKGREGRKEKEREGKKLRKKKLRMVTPPGKVTASRHISAYPKVVILSHFFYFYLPCTLCMWRVEGVRIGWMQPIIAHGDNSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.84
4 0.84
5 0.85
6 0.88
7 0.88
8 0.88
9 0.87
10 0.87
11 0.87
12 0.85
13 0.85
14 0.84
15 0.8
16 0.74
17 0.66
18 0.56
19 0.46
20 0.4
21 0.38
22 0.34
23 0.28
24 0.26
25 0.27
26 0.28
27 0.28
28 0.28
29 0.19
30 0.14
31 0.14
32 0.13
33 0.12
34 0.13
35 0.15
36 0.13
37 0.12
38 0.12
39 0.12
40 0.12
41 0.13
42 0.15
43 0.12
44 0.13
45 0.15
46 0.16
47 0.18
48 0.19
49 0.2
50 0.18
51 0.2
52 0.2
53 0.21
54 0.2
55 0.21
56 0.21
57 0.2
58 0.18
59 0.17
60 0.15
61 0.12
62 0.13
63 0.14
64 0.15