Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KPW2

Protein Details
Accession A0A3N4KPW2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
47-73QAEERAAKEKKKKEDKKKKVPKVPDHABasic
NLS Segment(s)
PositionSequence
51-69RAAKEKKKKEDKKKKVPKV
Subcellular Location(s) nucl 15.5, cyto_nucl 13.333, mito_nucl 9.666, cyto 9
Family & Domain DBs
Amino Acid Sequences MHHCPGGNHALDRSRCPKKGHVVQCPIHPDIYSFPGHQCATCKVIDQAEERAAKEKKKKEDKKKKVPKVPDHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.5
4 0.54
5 0.57
6 0.65
7 0.68
8 0.69
9 0.69
10 0.67
11 0.68
12 0.66
13 0.57
14 0.47
15 0.38
16 0.29
17 0.22
18 0.23
19 0.19
20 0.14
21 0.14
22 0.17
23 0.17
24 0.17
25 0.16
26 0.16
27 0.17
28 0.16
29 0.17
30 0.14
31 0.15
32 0.18
33 0.18
34 0.18
35 0.21
36 0.22
37 0.22
38 0.28
39 0.3
40 0.34
41 0.41
42 0.46
43 0.51
44 0.61
45 0.71
46 0.76
47 0.84
48 0.89
49 0.92
50 0.95
51 0.95
52 0.94
53 0.95