FuNGI

A0A3N4KP29

Protein Details

Accession

A0A3N4KP29

Localization Confidence

High

Confidence Score

15.1

NoLS Segment(s)

Position	Sequence	Protein Nature
366-396	GEEKEDKGRKWKKKGLKRQHRRVIMRPTAKT	Basic

NLS Segment(s)

Position	Sequence
370-388	EDKGRKWKKKGLKRQHRRV
454-493	RKGRKISEAAHANYRRVNIRGSKGAKAVNGRAGRFRGKRR

Subcellular Location(s)

nucl 20.5, cyto_nucl 14.5, cyto 5.5

Family & Domain DBs

InterPro	View protein in InterPro IPR021110 DNA_rep_checkpnt_protein IPR040203 Sld2
Gene Ontology	GO:0005634 C:nucleus GO:0007049 P:cell cycle GO:0006270 P:DNA replication initiation
Pfam	View protein in Pfam PF11719 Drc1-Sld2

Amino Acid Sequences

MAGTEAQKTLRQELKEWERAFADANGGRKPTREEIKRDKVIAAKYTEYYKIQPSSKAPKSKSSQSADPKPRDPKPHTSRFTTTTPTAIPYDPTNPFASGPSPSSSSVKSTTTIPSRPTTSTSVSTTSIFRTPSKPSQLHRDLYDSPLSTRGRRLFGNRIRDSVGPTPQKTGKVLGIFESFGAAVDDADTDAAAATPSHKRVLRPSPRKTTTTAAVASPALSTPRKRKAGEMGTPRTPGTTQKTPGTQRDVFSTPAFLRRSFIGSLEESPAVVEPRRRRPLVKGLSEMVKELRRWEDDAHRDDEEAMREMEREMEGAEAEALPVKKRVLEVVEVPVEVEENDPETGLPPLPEGAWREERRVEEEESGEEKEDKGRKWKKKGLKRQHRRVIMRPTAKTTTTTTTTGETDDAPPPPPNPEDAELPDAGYSDEDLSDLDNLPDEPVRKAVAVPVPVERKGRKISEAAHANYRRVNIRGSKGAKAVNGRAGRFRGKRR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.52
2	0.58
3	0.56
4	0.52
5	0.47
6	0.45
7	0.44
8	0.35
9	0.33
10	0.26
11	0.29
12	0.29
13	0.31
14	0.3
15	0.3
16	0.35
17	0.36
18	0.43
19	0.47
20	0.54
21	0.62
22	0.71
23	0.76
24	0.72
25	0.68
26	0.64
27	0.62
28	0.58
29	0.52
30	0.45
31	0.4
32	0.42
33	0.42
34	0.38
35	0.35
36	0.36
37	0.38
38	0.38
39	0.41
40	0.45
41	0.52
42	0.58
43	0.64
44	0.61
45	0.63
46	0.67
47	0.71
48	0.73
49	0.69
50	0.7
51	0.7
52	0.78
53	0.78
54	0.78
55	0.77
56	0.76
57	0.77
58	0.77
59	0.74
60	0.75
61	0.74
62	0.78
63	0.75
64	0.74
65	0.72
66	0.67
67	0.65
68	0.6
69	0.51
70	0.44
71	0.4
72	0.35
73	0.32
74	0.28
75	0.25
76	0.22
77	0.26
78	0.25
79	0.27
80	0.26
81	0.24
82	0.24
83	0.24
84	0.22
85	0.19
86	0.19
87	0.19
88	0.19
89	0.2
90	0.22
91	0.22
92	0.24
93	0.24
94	0.23
95	0.22
96	0.22
97	0.27
98	0.3
99	0.33
100	0.33
101	0.34
102	0.36
103	0.36
104	0.37
105	0.35
106	0.33
107	0.33
108	0.32
109	0.31
110	0.29
111	0.28
112	0.26
113	0.24
114	0.23
115	0.22
116	0.22
117	0.22
118	0.28
119	0.34
120	0.41
121	0.44
122	0.44
123	0.53
124	0.57
125	0.57
126	0.52
127	0.51
128	0.44
129	0.42
130	0.43
131	0.33
132	0.27
133	0.3
134	0.3
135	0.26
136	0.31
137	0.32
138	0.3
139	0.32
140	0.37
141	0.41
142	0.46
143	0.55
144	0.5
145	0.48
146	0.48
147	0.46
148	0.45
149	0.4
150	0.41
151	0.36
152	0.35
153	0.38
154	0.38
155	0.4
156	0.36
157	0.33
158	0.29
159	0.25
160	0.25
161	0.22
162	0.21
163	0.19
164	0.17
165	0.15
166	0.11
167	0.09
168	0.09
169	0.06
170	0.04
171	0.04
172	0.04
173	0.04
174	0.04
175	0.03
176	0.03
177	0.03
178	0.03
179	0.03
180	0.03
181	0.05
182	0.08
183	0.1
184	0.14
185	0.16
186	0.17
187	0.24
188	0.35
189	0.44
190	0.52
191	0.59
192	0.65
193	0.68
194	0.69
195	0.65
196	0.58
197	0.5
198	0.45
199	0.37
200	0.27
201	0.24
202	0.22
203	0.18
204	0.14
205	0.11
206	0.1
207	0.11
208	0.14
209	0.2
210	0.28
211	0.33
212	0.34
213	0.37
214	0.43
215	0.49
216	0.53
217	0.55
218	0.52
219	0.49
220	0.5
221	0.47
222	0.39
223	0.31
224	0.28
225	0.26
226	0.26
227	0.26
228	0.27
229	0.33
230	0.36
231	0.39
232	0.42
233	0.37
234	0.32
235	0.34
236	0.33
237	0.29
238	0.26
239	0.25
240	0.18
241	0.22
242	0.23
243	0.19
244	0.18
245	0.17
246	0.2
247	0.17
248	0.18
249	0.14
250	0.14
251	0.15
252	0.16
253	0.15
254	0.12
255	0.11
256	0.11
257	0.09
258	0.1
259	0.14
260	0.18
261	0.28
262	0.34
263	0.36
264	0.37
265	0.42
266	0.51
267	0.55
268	0.53
269	0.47
270	0.43
271	0.45
272	0.43
273	0.38
274	0.31
275	0.25
276	0.21
277	0.2
278	0.21
279	0.19
280	0.21
281	0.23
282	0.28
283	0.32
284	0.36
285	0.37
286	0.34
287	0.32
288	0.31
289	0.3
290	0.23
291	0.18
292	0.14
293	0.11
294	0.11
295	0.11
296	0.11
297	0.09
298	0.08
299	0.06
300	0.06
301	0.06
302	0.06
303	0.06
304	0.04
305	0.04
306	0.07
307	0.07
308	0.08
309	0.09
310	0.09
311	0.1
312	0.11
313	0.13
314	0.12
315	0.14
316	0.16
317	0.19
318	0.2
319	0.19
320	0.18
321	0.16
322	0.14
323	0.12
324	0.1
325	0.06
326	0.06
327	0.07
328	0.07
329	0.07
330	0.07
331	0.08
332	0.08
333	0.08
334	0.06
335	0.07
336	0.07
337	0.1
338	0.12
339	0.16
340	0.25
341	0.26
342	0.29
343	0.33
344	0.34
345	0.37
346	0.38
347	0.35
348	0.28
349	0.28
350	0.28
351	0.27
352	0.26
353	0.22
354	0.19
355	0.17
356	0.21
357	0.25
358	0.24
359	0.33
360	0.42
361	0.5
362	0.6
363	0.69
364	0.73
365	0.79
366	0.88
367	0.89
368	0.9
369	0.92
370	0.93
371	0.94
372	0.93
373	0.9
374	0.87
375	0.87
376	0.85
377	0.83
378	0.75
379	0.72
380	0.66
381	0.6
382	0.53
383	0.46
384	0.42
385	0.37
386	0.35
387	0.3
388	0.28
389	0.28
390	0.26
391	0.23
392	0.19
393	0.18
394	0.2
395	0.2
396	0.2
397	0.21
398	0.21
399	0.24
400	0.23
401	0.22
402	0.24
403	0.25
404	0.27
405	0.29
406	0.32
407	0.28
408	0.27
409	0.25
410	0.2
411	0.17
412	0.13
413	0.11
414	0.07
415	0.07
416	0.07
417	0.07
418	0.07
419	0.09
420	0.09
421	0.08
422	0.09
423	0.09
424	0.1
425	0.13
426	0.14
427	0.14
428	0.15
429	0.17
430	0.16
431	0.16
432	0.21
433	0.24
434	0.25
435	0.26
436	0.31
437	0.35
438	0.38
439	0.45
440	0.41
441	0.42
442	0.47
443	0.49
444	0.46
445	0.46
446	0.47
447	0.5
448	0.56
449	0.53
450	0.56
451	0.55
452	0.54
453	0.52
454	0.52
455	0.47
456	0.4
457	0.44
458	0.41
459	0.45
460	0.52
461	0.53
462	0.54
463	0.54
464	0.56
465	0.53
466	0.53
467	0.5
468	0.5
469	0.51
470	0.48
471	0.5
472	0.52
473	0.57

A0A3N4KP29

3D AlphaFold-predicted Structure Viewer