Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KCW4

Protein Details
Accession A0A3N4KCW4    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
236-256VGESRDKTRNRERKTKQILDIHydrophilic
NLS Segment(s)
PositionSequence
264-299REAGRGGARGGRGRGGDRGGRGRGDRGTRGDRDGDR
Subcellular Location(s) nucl 12, cyto_nucl 9.5, mito 6, cyto 5, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039764  HABP4/SERBP1  
IPR006861  HABP4_PAIRBP1-bd  
IPR019084  Stm1-like_N  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF04774  HABP4_PAI-RBP1  
PF09598  Stm1_N  
Amino Acid Sequences MSASVASQNPYDLLGNDIEDPDAPPPPAPRQVIKNTTTSKKRDEKPAPAVAPAVSGSRAGGYKRGRGGNDGAFRDREAGRQNNLAKNTDEDNTAPQGGARGRGGRRQYDRHSQTGRVDTEKQVGQGWGANKGEKEWDDELAGAELAQKDAAGADSADPNAVPASEDPAAAEGGATAEVPEEPEEVHKTYDEYLAELAQRQADLGPPTEVRRPNEGGNDKKWAAAKEFSREEGAYFVGESRDKTRNRERKTKQILDIEPRYVEPREAGRGGARGGRGRGGDRGGRGRGDRGTRGDRDGDRRGDYRGGKSSTGTPNLDDTSAFPSLGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.14
5 0.13
6 0.12
7 0.13
8 0.12
9 0.14
10 0.13
11 0.14
12 0.18
13 0.23
14 0.31
15 0.33
16 0.37
17 0.42
18 0.51
19 0.57
20 0.55
21 0.58
22 0.58
23 0.64
24 0.67
25 0.64
26 0.64
27 0.66
28 0.7
29 0.73
30 0.74
31 0.74
32 0.74
33 0.78
34 0.7
35 0.62
36 0.57
37 0.46
38 0.38
39 0.29
40 0.22
41 0.13
42 0.11
43 0.1
44 0.11
45 0.12
46 0.12
47 0.18
48 0.2
49 0.25
50 0.31
51 0.36
52 0.35
53 0.37
54 0.41
55 0.42
56 0.46
57 0.44
58 0.4
59 0.36
60 0.36
61 0.36
62 0.31
63 0.28
64 0.28
65 0.3
66 0.3
67 0.36
68 0.42
69 0.43
70 0.46
71 0.44
72 0.37
73 0.35
74 0.35
75 0.29
76 0.25
77 0.2
78 0.2
79 0.2
80 0.19
81 0.16
82 0.13
83 0.15
84 0.14
85 0.16
86 0.15
87 0.19
88 0.2
89 0.26
90 0.3
91 0.35
92 0.4
93 0.45
94 0.5
95 0.55
96 0.57
97 0.59
98 0.59
99 0.55
100 0.54
101 0.53
102 0.49
103 0.43
104 0.41
105 0.34
106 0.35
107 0.32
108 0.28
109 0.22
110 0.2
111 0.16
112 0.17
113 0.16
114 0.16
115 0.16
116 0.16
117 0.15
118 0.16
119 0.18
120 0.15
121 0.19
122 0.15
123 0.15
124 0.15
125 0.15
126 0.14
127 0.12
128 0.11
129 0.06
130 0.07
131 0.06
132 0.05
133 0.05
134 0.05
135 0.04
136 0.04
137 0.05
138 0.03
139 0.03
140 0.04
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.04
147 0.04
148 0.04
149 0.03
150 0.07
151 0.07
152 0.07
153 0.07
154 0.08
155 0.08
156 0.07
157 0.07
158 0.04
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.04
166 0.04
167 0.04
168 0.04
169 0.06
170 0.08
171 0.09
172 0.1
173 0.09
174 0.1
175 0.11
176 0.13
177 0.12
178 0.1
179 0.1
180 0.1
181 0.1
182 0.1
183 0.1
184 0.07
185 0.07
186 0.07
187 0.06
188 0.08
189 0.09
190 0.1
191 0.11
192 0.12
193 0.14
194 0.2
195 0.24
196 0.24
197 0.28
198 0.3
199 0.31
200 0.38
201 0.44
202 0.43
203 0.42
204 0.46
205 0.41
206 0.4
207 0.41
208 0.34
209 0.3
210 0.3
211 0.3
212 0.31
213 0.33
214 0.32
215 0.32
216 0.3
217 0.27
218 0.22
219 0.2
220 0.13
221 0.11
222 0.1
223 0.09
224 0.1
225 0.12
226 0.15
227 0.22
228 0.24
229 0.32
230 0.42
231 0.5
232 0.57
233 0.67
234 0.68
235 0.72
236 0.81
237 0.81
238 0.78
239 0.77
240 0.76
241 0.74
242 0.72
243 0.64
244 0.54
245 0.47
246 0.43
247 0.34
248 0.29
249 0.22
250 0.21
251 0.23
252 0.23
253 0.23
254 0.22
255 0.23
256 0.24
257 0.24
258 0.24
259 0.22
260 0.23
261 0.26
262 0.25
263 0.25
264 0.27
265 0.29
266 0.29
267 0.31
268 0.36
269 0.35
270 0.37
271 0.37
272 0.38
273 0.39
274 0.42
275 0.42
276 0.42
277 0.47
278 0.46
279 0.48
280 0.51
281 0.51
282 0.52
283 0.55
284 0.53
285 0.5
286 0.49
287 0.49
288 0.5
289 0.49
290 0.48
291 0.48
292 0.47
293 0.43
294 0.44
295 0.48
296 0.48
297 0.5
298 0.45
299 0.38
300 0.39
301 0.4
302 0.38
303 0.3
304 0.24
305 0.23
306 0.23