Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KF00

Protein Details
Accession A0A3N4KF00    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
37-65HERPGLKKKRLKSARHRKRFKAGFKKLVSBasic
NLS Segment(s)
PositionSequence
38-74ERPGLKKKRLKSARHRKRFKAGFKKLVSIAMEMKRKG
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences AGRSVQVRADLPSALSRLRMILTANNVKADQVRQRFHERPGLKKKRLKSARHRKRFKAGFKKLVSIAMEMKRKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.14
4 0.13
5 0.13
6 0.13
7 0.11
8 0.13
9 0.19
10 0.24
11 0.24
12 0.25
13 0.24
14 0.23
15 0.23
16 0.24
17 0.24
18 0.25
19 0.26
20 0.29
21 0.37
22 0.4
23 0.41
24 0.46
25 0.42
26 0.45
27 0.54
28 0.6
29 0.6
30 0.63
31 0.66
32 0.68
33 0.75
34 0.75
35 0.76
36 0.77
37 0.8
38 0.85
39 0.89
40 0.86
41 0.87
42 0.87
43 0.86
44 0.86
45 0.85
46 0.84
47 0.78
48 0.77
49 0.67
50 0.63
51 0.54
52 0.46
53 0.42
54 0.4