Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VAK3

Protein Details
Accession K1VAK3   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-24PSPPSTPPKVLKRRATSEPTHydrophilic
NLS Segment(s)
PositionSequence
71-95KPATARPTKRPRDDELAEKKVKPKR
Subcellular Location(s) nucl 8, cyto 7, mito_nucl 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR028009  ESCO_Acetyltransf_dom  
Pfam View protein in Pfam  
PF13880  Acetyltransf_13  
CDD cd04301  NAT_SF  
Amino Acid Sequences MLFTPSPPSTPPKVLKRRATSEPTSPSPKKPLADVDTNRSSSPLTTSSTPKLPPVPAKPKQGTLLGFITRKPATARPTKRPRDDELAEKKVKPKRNEQLVFTQGTRQTCKQCNMAWMRGVDDELHAQHHSRVLDGVPVTKAQSFSWTLATSKPLAKGSAAIYMADYTAGKVTEACDAVDRVLSAATLPTEVREKCKVFLAVVGTRIVGVAVSQPIKHAMAVIEDSGDAVKCDPKRLPTPLGIHRVFTVPSLRGQGLAVAMLDAAAGHTVYGRSFKPEEAAFSQPTEGGRKLMRKWGVTRVFEEDDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.76
3 0.79
4 0.8
5 0.8
6 0.8
7 0.74
8 0.73
9 0.71
10 0.67
11 0.68
12 0.65
13 0.61
14 0.61
15 0.61
16 0.54
17 0.5
18 0.53
19 0.49
20 0.56
21 0.55
22 0.55
23 0.56
24 0.56
25 0.52
26 0.44
27 0.38
28 0.29
29 0.28
30 0.22
31 0.19
32 0.21
33 0.26
34 0.29
35 0.33
36 0.34
37 0.33
38 0.35
39 0.36
40 0.41
41 0.46
42 0.52
43 0.55
44 0.63
45 0.63
46 0.63
47 0.61
48 0.58
49 0.5
50 0.44
51 0.41
52 0.36
53 0.34
54 0.3
55 0.32
56 0.27
57 0.27
58 0.25
59 0.26
60 0.29
61 0.38
62 0.46
63 0.51
64 0.62
65 0.7
66 0.75
67 0.75
68 0.74
69 0.73
70 0.69
71 0.68
72 0.66
73 0.66
74 0.6
75 0.57
76 0.58
77 0.57
78 0.61
79 0.56
80 0.57
81 0.58
82 0.66
83 0.68
84 0.65
85 0.66
86 0.62
87 0.6
88 0.5
89 0.45
90 0.37
91 0.36
92 0.36
93 0.31
94 0.34
95 0.37
96 0.39
97 0.38
98 0.37
99 0.42
100 0.44
101 0.43
102 0.39
103 0.34
104 0.32
105 0.28
106 0.27
107 0.19
108 0.14
109 0.12
110 0.1
111 0.11
112 0.1
113 0.1
114 0.1
115 0.13
116 0.12
117 0.11
118 0.11
119 0.09
120 0.12
121 0.11
122 0.12
123 0.09
124 0.1
125 0.1
126 0.11
127 0.12
128 0.09
129 0.12
130 0.12
131 0.13
132 0.14
133 0.14
134 0.14
135 0.14
136 0.15
137 0.14
138 0.14
139 0.15
140 0.14
141 0.14
142 0.13
143 0.14
144 0.13
145 0.15
146 0.14
147 0.12
148 0.11
149 0.11
150 0.1
151 0.09
152 0.08
153 0.04
154 0.05
155 0.05
156 0.05
157 0.05
158 0.06
159 0.08
160 0.08
161 0.08
162 0.08
163 0.08
164 0.09
165 0.09
166 0.08
167 0.06
168 0.05
169 0.05
170 0.04
171 0.04
172 0.04
173 0.05
174 0.05
175 0.06
176 0.11
177 0.11
178 0.15
179 0.21
180 0.22
181 0.22
182 0.27
183 0.26
184 0.22
185 0.24
186 0.25
187 0.21
188 0.21
189 0.2
190 0.16
191 0.15
192 0.15
193 0.12
194 0.06
195 0.05
196 0.05
197 0.07
198 0.08
199 0.08
200 0.09
201 0.11
202 0.12
203 0.11
204 0.11
205 0.09
206 0.09
207 0.1
208 0.1
209 0.08
210 0.08
211 0.08
212 0.08
213 0.07
214 0.06
215 0.06
216 0.11
217 0.11
218 0.16
219 0.18
220 0.23
221 0.3
222 0.35
223 0.38
224 0.4
225 0.47
226 0.5
227 0.57
228 0.52
229 0.47
230 0.43
231 0.4
232 0.34
233 0.28
234 0.25
235 0.17
236 0.18
237 0.21
238 0.2
239 0.19
240 0.19
241 0.18
242 0.14
243 0.13
244 0.11
245 0.07
246 0.06
247 0.06
248 0.05
249 0.04
250 0.03
251 0.03
252 0.03
253 0.03
254 0.04
255 0.05
256 0.06
257 0.1
258 0.1
259 0.15
260 0.17
261 0.18
262 0.22
263 0.23
264 0.28
265 0.29
266 0.34
267 0.3
268 0.3
269 0.3
270 0.27
271 0.28
272 0.27
273 0.23
274 0.22
275 0.27
276 0.32
277 0.35
278 0.42
279 0.46
280 0.48
281 0.51
282 0.58
283 0.61
284 0.59
285 0.59
286 0.57