Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KZK2

Protein Details
Accession A0A3N4KZK2   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
100-119TPLTADTGSKNKKKKKRGKPBasic
NLS Segment(s)
PositionSequence
109-119KNKKKKKRGKP
Subcellular Location(s) cyto 15.5, cyto_nucl 13, nucl 7.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MKITTTPQEFVDESLRLLEARPSATITTTYHAAASGKGKLTIKTYDPASGAVIKFRTCKIAVVGRMIAGLNRLGRQQANVPEPVVTVTSATGTPISGQATPLTADTGSKNKKKKKRGKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.14
4 0.15
5 0.15
6 0.12
7 0.13
8 0.13
9 0.14
10 0.14
11 0.15
12 0.17
13 0.15
14 0.16
15 0.16
16 0.15
17 0.14
18 0.14
19 0.13
20 0.13
21 0.14
22 0.14
23 0.14
24 0.17
25 0.18
26 0.19
27 0.21
28 0.22
29 0.22
30 0.22
31 0.22
32 0.21
33 0.2
34 0.2
35 0.18
36 0.18
37 0.16
38 0.15
39 0.15
40 0.13
41 0.14
42 0.14
43 0.16
44 0.13
45 0.14
46 0.14
47 0.19
48 0.19
49 0.2
50 0.2
51 0.16
52 0.17
53 0.16
54 0.13
55 0.09
56 0.09
57 0.07
58 0.08
59 0.08
60 0.09
61 0.1
62 0.11
63 0.15
64 0.2
65 0.22
66 0.22
67 0.22
68 0.21
69 0.21
70 0.2
71 0.16
72 0.1
73 0.08
74 0.07
75 0.07
76 0.07
77 0.08
78 0.07
79 0.06
80 0.07
81 0.08
82 0.1
83 0.09
84 0.1
85 0.1
86 0.11
87 0.12
88 0.11
89 0.11
90 0.09
91 0.1
92 0.13
93 0.22
94 0.3
95 0.37
96 0.46
97 0.55
98 0.65
99 0.75