Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4L240

Protein Details
Accession A0A3N4L240    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
49-73RDACAMPPKKNRSSRHRKRKRKKGRBasic
NLS Segment(s)
PositionSequence
56-73PKKNRSSRHRKRKRKKGR
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MNDIIKQKNKQTPSGKTVVSPPPPLPSPNQPRKPPNTPQCYLNPPHRARDACAMPPKKNRSSRHRKRKRKKGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.56
3 0.49
4 0.52
5 0.51
6 0.46
7 0.42
8 0.36
9 0.35
10 0.36
11 0.36
12 0.33
13 0.35
14 0.41
15 0.48
16 0.55
17 0.57
18 0.63
19 0.68
20 0.71
21 0.71
22 0.7
23 0.67
24 0.61
25 0.58
26 0.56
27 0.54
28 0.5
29 0.49
30 0.49
31 0.44
32 0.47
33 0.49
34 0.45
35 0.43
36 0.47
37 0.43
38 0.4
39 0.48
40 0.49
41 0.49
42 0.57
43 0.62
44 0.63
45 0.69
46 0.71
47 0.72
48 0.78
49 0.83
50 0.86
51 0.89
52 0.92
53 0.94