Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KVJ4

Protein Details
Accession A0A3N4KVJ4   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-77GDTETTKPQKKRVRKARGRSTASPENHydrophilic
NLS Segment(s)
PositionSequence
59-70PQKKRVRKARGR
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MPIPQRHLQSFDISDTMFPSFSNSPTRTPLLRESKSPANPPPELAEEEVYFGDTETTKPQKKRVRKARGRSTASPENETPFINPNAVVFIANIPGEVIGLEDDEPVEADNPPTMPYGMPTAQQLGIMRVLAAFNSSQNQDHSNGAGTDSTMPNSSQGSNPSYSSSGNVQASPSLLHSGGAGPGPSSMSASYTSGAAAAISQPAAPPGYTPDEDAQSTYDAPPPYTRGRRLTRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.21
4 0.15
5 0.12
6 0.15
7 0.15
8 0.17
9 0.25
10 0.26
11 0.28
12 0.33
13 0.37
14 0.33
15 0.36
16 0.43
17 0.45
18 0.45
19 0.46
20 0.47
21 0.52
22 0.56
23 0.57
24 0.54
25 0.51
26 0.49
27 0.47
28 0.45
29 0.39
30 0.36
31 0.32
32 0.28
33 0.22
34 0.22
35 0.2
36 0.17
37 0.13
38 0.11
39 0.1
40 0.08
41 0.09
42 0.14
43 0.22
44 0.28
45 0.31
46 0.4
47 0.49
48 0.59
49 0.68
50 0.73
51 0.77
52 0.81
53 0.89
54 0.91
55 0.91
56 0.89
57 0.83
58 0.8
59 0.78
60 0.7
61 0.64
62 0.54
63 0.47
64 0.4
65 0.35
66 0.28
67 0.23
68 0.21
69 0.16
70 0.15
71 0.12
72 0.12
73 0.12
74 0.11
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.05
81 0.05
82 0.05
83 0.04
84 0.04
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.05
97 0.05
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.09
104 0.1
105 0.1
106 0.09
107 0.11
108 0.1
109 0.11
110 0.11
111 0.09
112 0.09
113 0.08
114 0.07
115 0.06
116 0.06
117 0.05
118 0.05
119 0.04
120 0.05
121 0.06
122 0.08
123 0.08
124 0.1
125 0.12
126 0.13
127 0.13
128 0.13
129 0.13
130 0.12
131 0.12
132 0.1
133 0.09
134 0.1
135 0.1
136 0.1
137 0.1
138 0.09
139 0.1
140 0.11
141 0.12
142 0.11
143 0.14
144 0.16
145 0.17
146 0.17
147 0.18
148 0.18
149 0.18
150 0.18
151 0.17
152 0.19
153 0.19
154 0.19
155 0.17
156 0.16
157 0.16
158 0.15
159 0.14
160 0.11
161 0.1
162 0.09
163 0.09
164 0.09
165 0.1
166 0.1
167 0.09
168 0.07
169 0.07
170 0.08
171 0.07
172 0.08
173 0.07
174 0.08
175 0.1
176 0.1
177 0.11
178 0.1
179 0.1
180 0.09
181 0.09
182 0.07
183 0.06
184 0.05
185 0.06
186 0.06
187 0.06
188 0.06
189 0.07
190 0.08
191 0.08
192 0.08
193 0.11
194 0.17
195 0.18
196 0.21
197 0.23
198 0.25
199 0.26
200 0.26
201 0.23
202 0.19
203 0.2
204 0.18
205 0.21
206 0.19
207 0.2
208 0.22
209 0.26
210 0.34
211 0.4
212 0.46
213 0.5