Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KMM5

Protein Details
Accession A0A3N4KMM5   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-43RCEWREKQSGWREKRCRKKQREWREKVYGSBasic
NLS Segment(s)
PositionSequence
25-34REKRCRKKQR
Subcellular Location(s) plas 8, mito 6, nucl 5.5, cyto_nucl 4.5, E.R. 3, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKTWQGKGGKISGRCEWREKQSGWREKRCRKKQREWREKVYGSPGKTWQEKEVCRNVGKKCSVCDLAVVKPQYPNILFIPYLISPIPIPFIITYTTNHFLLATIDIVILLFLNQKALSPDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.56
3 0.54
4 0.55
5 0.58
6 0.55
7 0.58
8 0.61
9 0.67
10 0.7
11 0.74
12 0.77
13 0.79
14 0.88
15 0.89
16 0.9
17 0.89
18 0.91
19 0.92
20 0.93
21 0.94
22 0.91
23 0.89
24 0.88
25 0.8
26 0.71
27 0.7
28 0.64
29 0.54
30 0.49
31 0.45
32 0.4
33 0.42
34 0.4
35 0.36
36 0.38
37 0.38
38 0.41
39 0.43
40 0.42
41 0.41
42 0.46
43 0.42
44 0.42
45 0.44
46 0.39
47 0.33
48 0.34
49 0.32
50 0.27
51 0.27
52 0.22
53 0.2
54 0.24
55 0.24
56 0.2
57 0.2
58 0.2
59 0.2
60 0.18
61 0.18
62 0.14
63 0.16
64 0.15
65 0.14
66 0.17
67 0.13
68 0.14
69 0.12
70 0.11
71 0.09
72 0.1
73 0.11
74 0.08
75 0.09
76 0.08
77 0.09
78 0.1
79 0.11
80 0.13
81 0.17
82 0.2
83 0.19
84 0.19
85 0.18
86 0.17
87 0.17
88 0.17
89 0.11
90 0.08
91 0.08
92 0.08
93 0.07
94 0.07
95 0.06
96 0.05
97 0.06
98 0.06
99 0.08
100 0.08
101 0.09