Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KN79

Protein Details
Accession A0A3N4KN79    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-45WSLLKDRLNTRRPRPRRREEIRTAILHydrophilic
NLS Segment(s)
PositionSequence
30-37RRPRPRRR
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
IPR038717  Tc1-like_DDE_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF13358  DDE_3  
Amino Acid Sequences MPTLDWPPFSPNLNPIENIWSLLKDRLNTRRPRPRRREEIRTAILEEWDLITSEEITKYVDNMPERIQAVIDANGGHTHW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.26
3 0.28
4 0.25
5 0.26
6 0.21
7 0.17
8 0.17
9 0.2
10 0.2
11 0.18
12 0.24
13 0.31
14 0.39
15 0.46
16 0.54
17 0.62
18 0.7
19 0.79
20 0.83
21 0.83
22 0.85
23 0.86
24 0.86
25 0.82
26 0.81
27 0.74
28 0.65
29 0.57
30 0.46
31 0.38
32 0.28
33 0.2
34 0.12
35 0.09
36 0.07
37 0.06
38 0.06
39 0.06
40 0.07
41 0.07
42 0.06
43 0.08
44 0.07
45 0.09
46 0.11
47 0.15
48 0.16
49 0.18
50 0.21
51 0.24
52 0.25
53 0.23
54 0.21
55 0.18
56 0.19
57 0.18
58 0.16
59 0.12
60 0.12