Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KCM7

Protein Details
Accession A0A3N4KCM7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
16-44PLLHRTCAEPSKRRRRRRPSLPSPSPSRRBasic
NLS Segment(s)
PositionSequence
26-44SKRRRRRRPSLPSPSPSRR
Subcellular Location(s) nucl 11.5, mito 8, cyto_nucl 7.5, extr 3, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MIGPYPVLSCPVLSCPLLHRTCAEPSKRRRRRRPSLPSPSPSRRPGPIVEICDMAGRRMTARFRNKLGPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.25
4 0.26
5 0.25
6 0.24
7 0.25
8 0.31
9 0.37
10 0.41
11 0.41
12 0.5
13 0.61
14 0.69
15 0.77
16 0.81
17 0.85
18 0.89
19 0.91
20 0.91
21 0.91
22 0.92
23 0.89
24 0.84
25 0.82
26 0.78
27 0.73
28 0.67
29 0.59
30 0.51
31 0.46
32 0.42
33 0.41
34 0.4
35 0.37
36 0.34
37 0.31
38 0.29
39 0.29
40 0.27
41 0.21
42 0.17
43 0.14
44 0.14
45 0.18
46 0.24
47 0.3
48 0.4
49 0.46
50 0.49