Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KQU2

Protein Details
Accession A0A3N4KQU2    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
107-127ASPPPPPSKKGPKKKGGGGGGBasic
NLS Segment(s)
PositionSequence
96-128AAARKRIAASRASPPPPPSKKGPKKKGGGGGGG
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, cyto 8.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR041298  UBZ3  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0016740  F:transferase activity  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF18439  zf_UBZ  
PROSITE View protein in PROSITE  
PS51907  ZF_UBZ3  
Amino Acid Sequences GEVEGDLEEESLALPKLSPPLVEHGSSNNDQSPPPPALPSPTTPPPQPSPSPPPPPEETDTYTYTCPHCAAPIPLQDQAEHEDWHFAKSLAEQDKAAARKRIAASRASPPPPPSKKGPKKKGGGGGGGGGCLEKGQRRLAFGKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.11
4 0.12
5 0.12
6 0.13
7 0.19
8 0.22
9 0.23
10 0.22
11 0.22
12 0.27
13 0.28
14 0.28
15 0.25
16 0.23
17 0.22
18 0.22
19 0.23
20 0.2
21 0.2
22 0.2
23 0.17
24 0.21
25 0.24
26 0.26
27 0.28
28 0.3
29 0.32
30 0.32
31 0.36
32 0.36
33 0.39
34 0.38
35 0.38
36 0.42
37 0.47
38 0.54
39 0.51
40 0.51
41 0.49
42 0.51
43 0.48
44 0.43
45 0.38
46 0.33
47 0.34
48 0.31
49 0.28
50 0.25
51 0.22
52 0.19
53 0.16
54 0.12
55 0.11
56 0.1
57 0.12
58 0.14
59 0.17
60 0.18
61 0.2
62 0.2
63 0.2
64 0.19
65 0.2
66 0.19
67 0.15
68 0.13
69 0.15
70 0.14
71 0.15
72 0.15
73 0.11
74 0.1
75 0.11
76 0.18
77 0.17
78 0.18
79 0.17
80 0.18
81 0.23
82 0.26
83 0.28
84 0.26
85 0.23
86 0.29
87 0.32
88 0.36
89 0.34
90 0.35
91 0.35
92 0.38
93 0.46
94 0.42
95 0.43
96 0.41
97 0.49
98 0.5
99 0.51
100 0.52
101 0.56
102 0.64
103 0.72
104 0.78
105 0.78
106 0.8
107 0.83
108 0.83
109 0.77
110 0.7
111 0.61
112 0.56
113 0.46
114 0.38
115 0.3
116 0.21
117 0.15
118 0.12
119 0.12
120 0.12
121 0.15
122 0.23
123 0.25
124 0.3