Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KPL9

Protein Details
Accession A0A3N4KPL9   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
6-25GISRSRPRSRRQHLFAKEIRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto_nucl 7, nucl 6.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR003195  TFIID_TAF13  
Gene Ontology GO:0005634  C:nucleus  
GO:0046982  F:protein heterodimerization activity  
GO:0006366  P:transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF02269  TFIID-18kDa  
CDD cd07978  TAF13  
Amino Acid Sequences MATDAGISRSRPRSRRQHLFAKEIRSLMYAFGDDQEPLQESVNVLDEIVTDYIVDMCHDAARMASQARRNKIKVDDFKFALRRDPKKLGRVEELLVMAKVIADARKQFDDKQDVVEATAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.78
3 0.78
4 0.79
5 0.77
6 0.81
7 0.77
8 0.73
9 0.66
10 0.56
11 0.49
12 0.4
13 0.34
14 0.25
15 0.2
16 0.14
17 0.11
18 0.11
19 0.11
20 0.09
21 0.09
22 0.09
23 0.09
24 0.1
25 0.1
26 0.09
27 0.08
28 0.09
29 0.11
30 0.1
31 0.08
32 0.07
33 0.07
34 0.08
35 0.07
36 0.06
37 0.04
38 0.04
39 0.05
40 0.05
41 0.05
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.06
51 0.09
52 0.16
53 0.21
54 0.26
55 0.32
56 0.33
57 0.36
58 0.42
59 0.48
60 0.5
61 0.51
62 0.51
63 0.47
64 0.52
65 0.52
66 0.46
67 0.46
68 0.45
69 0.45
70 0.47
71 0.54
72 0.55
73 0.58
74 0.63
75 0.59
76 0.56
77 0.54
78 0.48
79 0.42
80 0.37
81 0.3
82 0.24
83 0.19
84 0.13
85 0.1
86 0.09
87 0.08
88 0.08
89 0.1
90 0.13
91 0.18
92 0.23
93 0.25
94 0.28
95 0.35
96 0.4
97 0.39
98 0.4
99 0.4
100 0.36
101 0.34