Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KYB7

Protein Details
Accession A0A3N4KYB7   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
170-201RVVITNRRTRKKVTRRKVTRRKVTRSSSHTTLHydrophilic
NLS Segment(s)
PositionSequence
176-191RRTRKKVTRRKVTRRK
Subcellular Location(s) mito 9.5, nucl 9, cyto_mito 8, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MASLLMGYVFHHPYIFYQWIRHRTFPRFMVGMPRSRSNPWIADDCALVIIHLDALMIDLKAQIGCCKQELQSGRCEPPYGFQHGFDLQEAILHLKLELDVYRHLKYHLFHCNSIPLSEDSESDNEEVYHEEVEDDEMVEAEGDEEKGDNEEEAMRRWMMLKWTRRSTTIRVVITNRRTRKKVTRRKVTRRKVTRSSSHTTLTNSYYINVTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.22
4 0.28
5 0.37
6 0.46
7 0.51
8 0.56
9 0.57
10 0.58
11 0.64
12 0.59
13 0.57
14 0.49
15 0.45
16 0.48
17 0.45
18 0.46
19 0.43
20 0.45
21 0.42
22 0.43
23 0.45
24 0.39
25 0.38
26 0.34
27 0.35
28 0.32
29 0.29
30 0.27
31 0.24
32 0.21
33 0.17
34 0.12
35 0.08
36 0.06
37 0.05
38 0.05
39 0.04
40 0.03
41 0.04
42 0.05
43 0.04
44 0.04
45 0.04
46 0.05
47 0.06
48 0.06
49 0.08
50 0.09
51 0.11
52 0.12
53 0.14
54 0.14
55 0.19
56 0.25
57 0.24
58 0.31
59 0.34
60 0.35
61 0.34
62 0.35
63 0.29
64 0.29
65 0.3
66 0.29
67 0.25
68 0.23
69 0.25
70 0.25
71 0.26
72 0.2
73 0.17
74 0.1
75 0.1
76 0.1
77 0.08
78 0.07
79 0.06
80 0.06
81 0.05
82 0.05
83 0.06
84 0.06
85 0.06
86 0.09
87 0.12
88 0.13
89 0.14
90 0.15
91 0.16
92 0.17
93 0.21
94 0.27
95 0.27
96 0.27
97 0.27
98 0.31
99 0.29
100 0.28
101 0.24
102 0.16
103 0.15
104 0.15
105 0.15
106 0.12
107 0.12
108 0.13
109 0.11
110 0.1
111 0.08
112 0.08
113 0.08
114 0.07
115 0.07
116 0.06
117 0.06
118 0.06
119 0.06
120 0.06
121 0.05
122 0.05
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.05
134 0.06
135 0.05
136 0.05
137 0.09
138 0.09
139 0.11
140 0.13
141 0.12
142 0.12
143 0.14
144 0.15
145 0.2
146 0.27
147 0.34
148 0.41
149 0.49
150 0.51
151 0.54
152 0.58
153 0.56
154 0.58
155 0.57
156 0.51
157 0.48
158 0.51
159 0.56
160 0.6
161 0.64
162 0.63
163 0.63
164 0.64
165 0.68
166 0.74
167 0.76
168 0.78
169 0.79
170 0.82
171 0.85
172 0.93
173 0.95
174 0.95
175 0.95
176 0.94
177 0.93
178 0.92
179 0.9
180 0.89
181 0.85
182 0.82
183 0.76
184 0.7
185 0.64
186 0.58
187 0.52
188 0.45
189 0.41
190 0.33
191 0.29