Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VEV3

Protein Details
Accession K1VEV3    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-46QLQKNHFRKDWQRRVKTWFDQPGKKKSRRVARSKKALASGHydrophilic
NLS Segment(s)
PositionSequence
28-42PGKKKSRRVARSKKA
187-207YAGIRAKRAADKKAAAEEAKK
Subcellular Location(s) nucl 14, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001380  Ribosomal_L13e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01294  Ribosomal_L13e  
Amino Acid Sequences MVKHNNQLQKNHFRKDWQRRVKTWFDQPGKKKSRRVARSKKALASGAAPLQRLRSVVRCPTQRYNIRVREGRGFTISELKLAGIPRKQAKGLGIVVDHRRRSKSEEGQKANVERLQAYKERLVVFPRVHGKPKAGDAQGEDLTAHITRELPAIVNTYTAEKPRAITEEEKSFEAYTTLRKARSDARYAGIRAKRAADKKAAAEEAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.77
3 0.79
4 0.79
5 0.8
6 0.79
7 0.83
8 0.83
9 0.8
10 0.78
11 0.77
12 0.75
13 0.76
14 0.77
15 0.81
16 0.81
17 0.81
18 0.79
19 0.77
20 0.79
21 0.8
22 0.83
23 0.84
24 0.84
25 0.88
26 0.87
27 0.83
28 0.77
29 0.68
30 0.58
31 0.49
32 0.42
33 0.36
34 0.31
35 0.26
36 0.22
37 0.22
38 0.21
39 0.2
40 0.19
41 0.19
42 0.22
43 0.29
44 0.36
45 0.39
46 0.45
47 0.51
48 0.58
49 0.6
50 0.6
51 0.63
52 0.62
53 0.64
54 0.62
55 0.57
56 0.56
57 0.52
58 0.48
59 0.4
60 0.34
61 0.27
62 0.31
63 0.27
64 0.19
65 0.17
66 0.15
67 0.16
68 0.16
69 0.19
70 0.13
71 0.18
72 0.21
73 0.23
74 0.23
75 0.23
76 0.22
77 0.23
78 0.22
79 0.19
80 0.16
81 0.17
82 0.23
83 0.26
84 0.28
85 0.26
86 0.27
87 0.27
88 0.32
89 0.36
90 0.39
91 0.44
92 0.51
93 0.53
94 0.55
95 0.57
96 0.52
97 0.46
98 0.38
99 0.29
100 0.2
101 0.17
102 0.17
103 0.17
104 0.18
105 0.18
106 0.2
107 0.21
108 0.21
109 0.22
110 0.24
111 0.22
112 0.24
113 0.3
114 0.29
115 0.32
116 0.33
117 0.33
118 0.3
119 0.34
120 0.35
121 0.29
122 0.27
123 0.25
124 0.28
125 0.26
126 0.24
127 0.2
128 0.13
129 0.14
130 0.13
131 0.11
132 0.06
133 0.07
134 0.07
135 0.08
136 0.08
137 0.08
138 0.08
139 0.1
140 0.1
141 0.11
142 0.11
143 0.13
144 0.15
145 0.16
146 0.17
147 0.16
148 0.17
149 0.18
150 0.21
151 0.21
152 0.23
153 0.26
154 0.32
155 0.33
156 0.33
157 0.32
158 0.3
159 0.26
160 0.24
161 0.2
162 0.18
163 0.23
164 0.27
165 0.27
166 0.28
167 0.31
168 0.38
169 0.45
170 0.46
171 0.42
172 0.43
173 0.47
174 0.48
175 0.54
176 0.5
177 0.47
178 0.43
179 0.45
180 0.48
181 0.48
182 0.52
183 0.51
184 0.51
185 0.52
186 0.56
187 0.56