Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4L0U3

Protein Details
Accession A0A3N4L0U3    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
290-321TEYWDKENKARYKRRKAVKRWWHWRPPGLRRGBasic
438-457GTGKRKTGSKGKGRGRKTAVBasic
NLS Segment(s)
PositionSequence
298-323KARYKRRKAVKRWWHWRPPGLRRGVA
440-456GKRKTGSKGKGRGRKTA
Subcellular Location(s) nucl 11cyto 11cyto_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR005605  Spo7  
Gene Ontology GO:0016020  C:membrane  
GO:0019888  F:protein phosphatase regulator activity  
Pfam View protein in Pfam  
PF03907  Spo7  
Amino Acid Sequences MTLSSPGSATSESIDLAVKGSLPTRSSLSPPSVVPKPPPAPPGNPLDYAPNSPNQVYLNLLILEASLRSQYLHHLARRRKFTFFVVLLLAWNAYFLHRIFDLGGSPYYYIYHLEWLGLLGGCVTAALYYATGLYEKTIVEPRRFVSTANRGLRGFNVKLVKVPFSTTQWIVWWWNWYTFPTPPPPRRPPSSTASRRLSANTAKPRRLSSNTPRKAAAAMQAAEHRHAPSIASSAMSRTSSQLAPHPEEAMEDDPADEIEEYLTGGLHLKLVILPKRFSATFREEWENYRTEYWDKENKARYKRRKAVKRWWHWRPPGLRRGVAAAAAAAGKKEDVPATTTATATATGSPAGRVRRASVASERRSPSVSSRAGTPEPEGTPTKRRGGSFVAKRRPNMAPGLVPGGKSGDVSDSGSTTTVGTEGRSDSSTVVDRSSSSAGTGKRKTGSKGKGRGRKTAVAGRSADG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.11
4 0.11
5 0.1
6 0.1
7 0.12
8 0.15
9 0.15
10 0.17
11 0.2
12 0.22
13 0.25
14 0.3
15 0.32
16 0.31
17 0.32
18 0.36
19 0.38
20 0.39
21 0.4
22 0.44
23 0.44
24 0.46
25 0.52
26 0.51
27 0.5
28 0.51
29 0.55
30 0.5
31 0.48
32 0.43
33 0.42
34 0.4
35 0.39
36 0.37
37 0.33
38 0.32
39 0.3
40 0.31
41 0.26
42 0.24
43 0.22
44 0.21
45 0.19
46 0.16
47 0.16
48 0.13
49 0.12
50 0.11
51 0.09
52 0.08
53 0.06
54 0.06
55 0.07
56 0.07
57 0.11
58 0.19
59 0.25
60 0.3
61 0.39
62 0.48
63 0.56
64 0.65
65 0.64
66 0.6
67 0.57
68 0.56
69 0.56
70 0.48
71 0.42
72 0.34
73 0.31
74 0.28
75 0.25
76 0.2
77 0.11
78 0.1
79 0.08
80 0.06
81 0.08
82 0.08
83 0.1
84 0.1
85 0.11
86 0.11
87 0.12
88 0.13
89 0.12
90 0.13
91 0.11
92 0.12
93 0.11
94 0.11
95 0.11
96 0.12
97 0.1
98 0.12
99 0.12
100 0.11
101 0.11
102 0.11
103 0.11
104 0.09
105 0.08
106 0.05
107 0.05
108 0.04
109 0.04
110 0.04
111 0.02
112 0.03
113 0.03
114 0.03
115 0.03
116 0.04
117 0.04
118 0.05
119 0.05
120 0.05
121 0.06
122 0.06
123 0.09
124 0.16
125 0.19
126 0.21
127 0.24
128 0.24
129 0.3
130 0.3
131 0.29
132 0.3
133 0.35
134 0.43
135 0.45
136 0.46
137 0.4
138 0.41
139 0.43
140 0.4
141 0.32
142 0.28
143 0.28
144 0.25
145 0.28
146 0.29
147 0.28
148 0.22
149 0.24
150 0.21
151 0.21
152 0.24
153 0.21
154 0.2
155 0.19
156 0.2
157 0.2
158 0.18
159 0.19
160 0.16
161 0.17
162 0.17
163 0.18
164 0.19
165 0.19
166 0.21
167 0.27
168 0.34
169 0.4
170 0.48
171 0.55
172 0.58
173 0.62
174 0.65
175 0.6
176 0.58
177 0.62
178 0.6
179 0.6
180 0.59
181 0.55
182 0.51
183 0.47
184 0.45
185 0.4
186 0.41
187 0.43
188 0.45
189 0.46
190 0.47
191 0.48
192 0.49
193 0.48
194 0.48
195 0.48
196 0.53
197 0.55
198 0.55
199 0.53
200 0.48
201 0.44
202 0.37
203 0.31
204 0.24
205 0.19
206 0.18
207 0.2
208 0.2
209 0.2
210 0.2
211 0.15
212 0.11
213 0.1
214 0.1
215 0.07
216 0.09
217 0.08
218 0.08
219 0.07
220 0.08
221 0.09
222 0.09
223 0.09
224 0.09
225 0.11
226 0.11
227 0.12
228 0.16
229 0.18
230 0.2
231 0.21
232 0.2
233 0.17
234 0.17
235 0.18
236 0.15
237 0.11
238 0.08
239 0.08
240 0.07
241 0.07
242 0.07
243 0.05
244 0.04
245 0.03
246 0.03
247 0.03
248 0.03
249 0.03
250 0.03
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.06
257 0.1
258 0.15
259 0.16
260 0.17
261 0.17
262 0.2
263 0.21
264 0.21
265 0.23
266 0.25
267 0.26
268 0.3
269 0.35
270 0.33
271 0.36
272 0.38
273 0.34
274 0.28
275 0.26
276 0.23
277 0.19
278 0.21
279 0.24
280 0.28
281 0.3
282 0.36
283 0.43
284 0.5
285 0.58
286 0.66
287 0.71
288 0.75
289 0.8
290 0.83
291 0.85
292 0.87
293 0.88
294 0.89
295 0.89
296 0.88
297 0.9
298 0.89
299 0.85
300 0.83
301 0.82
302 0.8
303 0.78
304 0.73
305 0.64
306 0.55
307 0.52
308 0.45
309 0.35
310 0.26
311 0.17
312 0.12
313 0.11
314 0.1
315 0.06
316 0.06
317 0.05
318 0.05
319 0.07
320 0.07
321 0.07
322 0.1
323 0.12
324 0.16
325 0.17
326 0.17
327 0.16
328 0.15
329 0.15
330 0.13
331 0.12
332 0.08
333 0.08
334 0.09
335 0.1
336 0.13
337 0.15
338 0.17
339 0.18
340 0.2
341 0.25
342 0.26
343 0.29
344 0.35
345 0.42
346 0.44
347 0.51
348 0.5
349 0.47
350 0.47
351 0.45
352 0.4
353 0.4
354 0.38
355 0.31
356 0.32
357 0.36
358 0.35
359 0.35
360 0.32
361 0.28
362 0.25
363 0.29
364 0.29
365 0.28
366 0.34
367 0.38
368 0.43
369 0.42
370 0.42
371 0.42
372 0.47
373 0.53
374 0.56
375 0.61
376 0.64
377 0.65
378 0.66
379 0.67
380 0.63
381 0.56
382 0.52
383 0.45
384 0.38
385 0.35
386 0.41
387 0.36
388 0.33
389 0.29
390 0.26
391 0.22
392 0.19
393 0.17
394 0.12
395 0.12
396 0.14
397 0.14
398 0.13
399 0.13
400 0.13
401 0.13
402 0.11
403 0.1
404 0.09
405 0.09
406 0.09
407 0.1
408 0.11
409 0.13
410 0.14
411 0.15
412 0.14
413 0.17
414 0.21
415 0.2
416 0.2
417 0.18
418 0.18
419 0.21
420 0.22
421 0.19
422 0.16
423 0.2
424 0.25
425 0.33
426 0.37
427 0.39
428 0.43
429 0.47
430 0.52
431 0.57
432 0.62
433 0.63
434 0.7
435 0.75
436 0.78
437 0.79
438 0.82
439 0.79
440 0.76
441 0.74
442 0.72
443 0.66
444 0.64