Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KVY1

Protein Details
Accession A0A3N4KVY1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
40-59LYPCWQRRTGRKRAVTQKCFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, E.R. 5, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSCSVFFSFYLAFFVYECNMMFRAGLFLISYIVFSLLLLLYPCWQRRTGRKRAVTQKCFWSYIIVILFLSSAPDMVRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.11
4 0.11
5 0.1
6 0.1
7 0.1
8 0.1
9 0.09
10 0.1
11 0.08
12 0.08
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.05
19 0.05
20 0.04
21 0.04
22 0.04
23 0.03
24 0.04
25 0.04
26 0.04
27 0.06
28 0.09
29 0.11
30 0.12
31 0.15
32 0.18
33 0.29
34 0.37
35 0.46
36 0.53
37 0.59
38 0.67
39 0.75
40 0.83
41 0.79
42 0.75
43 0.74
44 0.69
45 0.63
46 0.54
47 0.47
48 0.37
49 0.35
50 0.31
51 0.22
52 0.17
53 0.15
54 0.15
55 0.11
56 0.12
57 0.07
58 0.06