Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KWQ5

Protein Details
Accession A0A3N4KWQ5    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
23-42RTNPGKGRRRRTSVRQATKLHydrophilic
NLS Segment(s)
PositionSequence
27-33GKGRRRR
Subcellular Location(s) mito 20, nucl 3, plas 1, extr 1, E.R. 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MDVHLCTVLTISCLVISSSSRMRTNPGKGRRRRTSVRQATKLSSPPIRQDSQWGWGGWRPRSTTTGAATGKKKNICGEKAKVTIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.11
5 0.15
6 0.19
7 0.21
8 0.21
9 0.26
10 0.32
11 0.4
12 0.46
13 0.52
14 0.58
15 0.65
16 0.75
17 0.78
18 0.79
19 0.77
20 0.77
21 0.78
22 0.79
23 0.8
24 0.77
25 0.71
26 0.66
27 0.62
28 0.55
29 0.48
30 0.41
31 0.33
32 0.31
33 0.33
34 0.32
35 0.28
36 0.31
37 0.29
38 0.29
39 0.3
40 0.26
41 0.22
42 0.24
43 0.29
44 0.27
45 0.29
46 0.27
47 0.27
48 0.29
49 0.31
50 0.33
51 0.3
52 0.35
53 0.34
54 0.37
55 0.39
56 0.43
57 0.47
58 0.45
59 0.46
60 0.45
61 0.51
62 0.52
63 0.56
64 0.57
65 0.59