FuNGI

A0A3N4KAY5

Protein Details

Accession

A0A3N4KAY5

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
66-85	DAARAQLRRRRQKDGGFFVR	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

plas 22, mito 2, vacu 2

Family & Domain DBs

InterPro	View protein in InterPro IPR014743 Cl-channel_core IPR001807 Cl-channel_volt-gated
Gene Ontology	GO:0016020 C:membrane GO:0005247 F:voltage-gated chloride channel activity
Pfam	View protein in Pfam PF00654 Voltage_CLC

Amino Acid Sequences

MSAPSPRLRPQLRPSLSSRLSIAISTRSADEERGAHRNPHQQQEHFEEIDEIRRYEDFTTIDWVQDAARAQLRRRRQKDGGFFVRGSAEGWRWKLRQSYEAGQAWIVISLIGRVVLLLLLFYCVVGRRGKWKWKCVCIGLNASFLNIITEWLSDIRMGRCTTAFYLNENFCCWGSDEAEADSDLMCRMPRMAALEYDMALQPHPLYSLLRSYPTSSSTTSTSAPPLTPLTPPAQVLFAYTSAILVKSFAPYAAGSGISEIKCILAGFVMKGFLGGWTLLIKSIGLPLAIASGLSVGKEGPSVHYAVCTGNVISRFFAKYRRNAAKMREILSACAAAGVAVAFGSPIGGVLFSLEEMSSNFPLKTMWRSYFCALVATAVLAAMNPFRTGQLVMFQVSYDRDWHFFEVVFFVIIGVFGGLYGEFVIKWNLRAQSFRKRYLKEYAIAEVTFLAGVTAVICYANMFLRIDMTESMEILFLVELFLWF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.65
2	0.65
3	0.63
4	0.56
5	0.49
6	0.41
7	0.37
8	0.33
9	0.3
10	0.24
11	0.23
12	0.22
13	0.21
14	0.21
15	0.21
16	0.21
17	0.22
18	0.22
19	0.26
20	0.32
21	0.33
22	0.35
23	0.41
24	0.5
25	0.53
26	0.59
27	0.61
28	0.58
29	0.62
30	0.65
31	0.64
32	0.55
33	0.49
34	0.42
35	0.35
36	0.39
37	0.35
38	0.27
39	0.22
40	0.22
41	0.23
42	0.21
43	0.24
44	0.18
45	0.17
46	0.23
47	0.22
48	0.22
49	0.2
50	0.19
51	0.15
52	0.17
53	0.16
54	0.13
55	0.19
56	0.22
57	0.27
58	0.34
59	0.45
60	0.53
61	0.58
62	0.64
63	0.67
64	0.73
65	0.78
66	0.8
67	0.78
68	0.73
69	0.67
70	0.59
71	0.52
72	0.42
73	0.33
74	0.25
75	0.21
76	0.21
77	0.25
78	0.3
79	0.3
80	0.34
81	0.39
82	0.39
83	0.41
84	0.42
85	0.44
86	0.46
87	0.48
88	0.44
89	0.38
90	0.35
91	0.29
92	0.23
93	0.17
94	0.08
95	0.06
96	0.05
97	0.05
98	0.04
99	0.04
100	0.04
101	0.04
102	0.04
103	0.04
104	0.03
105	0.03
106	0.04
107	0.04
108	0.04
109	0.05
110	0.05
111	0.08
112	0.1
113	0.11
114	0.19
115	0.27
116	0.37
117	0.44
118	0.54
119	0.59
120	0.65
121	0.69
122	0.67
123	0.64
124	0.6
125	0.6
126	0.52
127	0.47
128	0.39
129	0.34
130	0.28
131	0.23
132	0.19
133	0.11
134	0.1
135	0.06
136	0.06
137	0.07
138	0.07
139	0.07
140	0.07
141	0.09
142	0.1
143	0.13
144	0.14
145	0.14
146	0.14
147	0.16
148	0.17
149	0.21
150	0.2
151	0.19
152	0.24
153	0.25
154	0.25
155	0.24
156	0.23
157	0.18
158	0.18
159	0.17
160	0.13
161	0.12
162	0.13
163	0.12
164	0.12
165	0.12
166	0.11
167	0.1
168	0.08
169	0.07
170	0.06
171	0.06
172	0.05
173	0.05
174	0.05
175	0.05
176	0.06
177	0.09
178	0.1
179	0.1
180	0.12
181	0.13
182	0.13
183	0.13
184	0.13
185	0.09
186	0.08
187	0.08
188	0.06
189	0.06
190	0.06
191	0.06
192	0.06
193	0.07
194	0.1
195	0.11
196	0.13
197	0.13
198	0.15
199	0.16
200	0.18
201	0.19
202	0.17
203	0.18
204	0.17
205	0.19
206	0.18
207	0.17
208	0.16
209	0.15
210	0.14
211	0.13
212	0.13
213	0.12
214	0.12
215	0.13
216	0.13
217	0.14
218	0.14
219	0.13
220	0.12
221	0.11
222	0.11
223	0.1
224	0.08
225	0.08
226	0.07
227	0.07
228	0.06
229	0.06
230	0.05
231	0.05
232	0.05
233	0.05
234	0.06
235	0.05
236	0.06
237	0.06
238	0.06
239	0.06
240	0.06
241	0.05
242	0.06
243	0.09
244	0.08
245	0.08
246	0.08
247	0.07
248	0.07
249	0.07
250	0.06
251	0.04
252	0.04
253	0.04
254	0.05
255	0.05
256	0.05
257	0.05
258	0.05
259	0.04
260	0.05
261	0.04
262	0.04
263	0.05
264	0.05
265	0.05
266	0.05
267	0.05
268	0.04
269	0.06
270	0.05
271	0.05
272	0.05
273	0.04
274	0.05
275	0.05
276	0.04
277	0.03
278	0.04
279	0.04
280	0.04
281	0.04
282	0.04
283	0.04
284	0.05
285	0.06
286	0.07
287	0.08
288	0.09
289	0.09
290	0.09
291	0.1
292	0.09
293	0.1
294	0.09
295	0.08
296	0.09
297	0.11
298	0.11
299	0.11
300	0.13
301	0.14
302	0.15
303	0.23
304	0.26
305	0.31
306	0.4
307	0.48
308	0.51
309	0.54
310	0.59
311	0.6
312	0.6
313	0.56
314	0.52
315	0.44
316	0.4
317	0.36
318	0.31
319	0.21
320	0.16
321	0.13
322	0.06
323	0.06
324	0.05
325	0.03
326	0.03
327	0.03
328	0.02
329	0.02
330	0.02
331	0.02
332	0.02
333	0.02
334	0.03
335	0.03
336	0.03
337	0.04
338	0.04
339	0.04
340	0.04
341	0.04
342	0.05
343	0.08
344	0.09
345	0.11
346	0.11
347	0.11
348	0.12
349	0.14
350	0.19
351	0.22
352	0.26
353	0.29
354	0.33
355	0.34
356	0.37
357	0.34
358	0.3
359	0.24
360	0.2
361	0.16
362	0.12
363	0.1
364	0.06
365	0.06
366	0.04
367	0.05
368	0.05
369	0.06
370	0.06
371	0.06
372	0.07
373	0.08
374	0.09
375	0.1
376	0.13
377	0.14
378	0.14
379	0.14
380	0.14
381	0.15
382	0.15
383	0.16
384	0.15
385	0.15
386	0.16
387	0.18
388	0.21
389	0.2
390	0.19
391	0.19
392	0.18
393	0.16
394	0.14
395	0.12
396	0.09
397	0.08
398	0.07
399	0.06
400	0.04
401	0.03
402	0.03
403	0.03
404	0.03
405	0.03
406	0.04
407	0.04
408	0.04
409	0.06
410	0.1
411	0.11
412	0.13
413	0.18
414	0.23
415	0.25
416	0.31
417	0.37
418	0.44
419	0.51
420	0.59
421	0.63
422	0.62
423	0.65
424	0.69
425	0.68
426	0.63
427	0.59
428	0.54
429	0.49
430	0.45
431	0.4
432	0.3
433	0.24
434	0.18
435	0.14
436	0.08
437	0.05
438	0.05
439	0.05
440	0.04
441	0.04
442	0.04
443	0.04
444	0.05
445	0.06
446	0.08
447	0.1
448	0.1
449	0.1
450	0.12
451	0.13
452	0.15
453	0.15
454	0.17
455	0.16
456	0.15
457	0.16
458	0.14
459	0.13
460	0.11
461	0.1
462	0.06
463	0.06

A0A3N4KAY5

3D AlphaFold-predicted Structure Viewer