Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4L3V3

Protein Details
Accession A0A3N4L3V3   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
95-121FNDVSKYSQKYKKQRRKVPQLDARPYIHydrophilic
NLS Segment(s)
PositionSequence
8-18GGRGGGGGRGG
144-149KKAIKK
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, cyto 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR024661  RNA_pol_III_Rpc31  
Gene Ontology GO:0005666  C:RNA polymerase III complex  
GO:0006383  P:transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF11705  RNA_pol_3_Rpc31  
Amino Acid Sequences MSRGGARGGRGGGGGRGGRGGGGFGGFGGFGGGFDDLVPDYSVTELFPPQPPPVQSSLIKEERAIIARFRSHREKIHNGPMYTIMSKKRGMEDPFNDVSKYSQKYKKQRRKVPQLDARPYIHELFPLELHLTLGIDPEEVNGKKKAIKKKLQFSALDTLDPLGDLADGAGSDIEEGAEGADREGAEKKKGGLLRGLLGEEAGDDEDEEQEPEEEEIEDDFGDDEEGDYNAEQYFDDGDDIGDDWGDEGGGEDYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.15
4 0.14
5 0.13
6 0.12
7 0.12
8 0.07
9 0.07
10 0.06
11 0.05
12 0.06
13 0.05
14 0.05
15 0.05
16 0.04
17 0.04
18 0.05
19 0.05
20 0.05
21 0.05
22 0.06
23 0.06
24 0.07
25 0.07
26 0.06
27 0.07
28 0.07
29 0.08
30 0.07
31 0.08
32 0.09
33 0.11
34 0.14
35 0.16
36 0.18
37 0.22
38 0.23
39 0.26
40 0.28
41 0.31
42 0.3
43 0.32
44 0.38
45 0.38
46 0.37
47 0.33
48 0.32
49 0.3
50 0.31
51 0.27
52 0.21
53 0.21
54 0.27
55 0.29
56 0.33
57 0.38
58 0.39
59 0.44
60 0.5
61 0.55
62 0.55
63 0.63
64 0.64
65 0.56
66 0.53
67 0.49
68 0.43
69 0.36
70 0.33
71 0.26
72 0.23
73 0.24
74 0.24
75 0.26
76 0.29
77 0.32
78 0.36
79 0.36
80 0.39
81 0.4
82 0.4
83 0.36
84 0.3
85 0.28
86 0.26
87 0.27
88 0.27
89 0.32
90 0.4
91 0.51
92 0.62
93 0.7
94 0.75
95 0.82
96 0.85
97 0.89
98 0.9
99 0.89
100 0.87
101 0.86
102 0.82
103 0.76
104 0.67
105 0.57
106 0.5
107 0.41
108 0.32
109 0.23
110 0.17
111 0.13
112 0.12
113 0.1
114 0.08
115 0.07
116 0.07
117 0.06
118 0.06
119 0.05
120 0.05
121 0.04
122 0.04
123 0.04
124 0.04
125 0.08
126 0.09
127 0.11
128 0.12
129 0.13
130 0.18
131 0.24
132 0.34
133 0.39
134 0.48
135 0.54
136 0.63
137 0.69
138 0.71
139 0.66
140 0.6
141 0.58
142 0.5
143 0.41
144 0.32
145 0.25
146 0.18
147 0.17
148 0.13
149 0.05
150 0.04
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.02
158 0.03
159 0.03
160 0.03
161 0.02
162 0.03
163 0.03
164 0.04
165 0.04
166 0.04
167 0.05
168 0.05
169 0.07
170 0.12
171 0.14
172 0.15
173 0.16
174 0.17
175 0.21
176 0.24
177 0.24
178 0.23
179 0.24
180 0.25
181 0.25
182 0.25
183 0.19
184 0.17
185 0.15
186 0.11
187 0.09
188 0.07
189 0.05
190 0.05
191 0.05
192 0.06
193 0.07
194 0.07
195 0.07
196 0.07
197 0.08
198 0.08
199 0.08
200 0.07
201 0.08
202 0.08
203 0.08
204 0.07
205 0.07
206 0.07
207 0.06
208 0.06
209 0.06
210 0.06
211 0.06
212 0.07
213 0.07
214 0.07
215 0.07
216 0.07
217 0.08
218 0.07
219 0.07
220 0.08
221 0.08
222 0.09
223 0.08
224 0.08
225 0.08
226 0.09
227 0.08
228 0.07
229 0.06
230 0.06
231 0.06
232 0.05
233 0.05
234 0.05