Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KS29

Protein Details
Accession A0A3N4KS29    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-23ADKGLPRLRKRGKKMLFFPRLLHydrophilic
NLS Segment(s)
PositionSequence
8-15RLRKRGKK
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MADKGLPRLRKRGKKMLFFPRLLIVDNVSLIRLQPLLDTLRQQHTQLRAQNDKLVRVGVAMEGTLRPVEEGMRIEREKRAAEEAAGRTKYGGGRGEEGRGDEGVRSVGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.85
3 0.85
4 0.83
5 0.75
6 0.68
7 0.63
8 0.55
9 0.46
10 0.38
11 0.28
12 0.2
13 0.19
14 0.17
15 0.12
16 0.1
17 0.09
18 0.09
19 0.07
20 0.06
21 0.06
22 0.08
23 0.1
24 0.11
25 0.13
26 0.15
27 0.2
28 0.21
29 0.22
30 0.24
31 0.26
32 0.31
33 0.34
34 0.37
35 0.36
36 0.36
37 0.4
38 0.37
39 0.33
40 0.28
41 0.24
42 0.17
43 0.13
44 0.12
45 0.07
46 0.06
47 0.05
48 0.04
49 0.04
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.05
56 0.06
57 0.08
58 0.1
59 0.15
60 0.16
61 0.18
62 0.2
63 0.23
64 0.23
65 0.23
66 0.25
67 0.2
68 0.21
69 0.26
70 0.28
71 0.32
72 0.31
73 0.29
74 0.26
75 0.27
76 0.27
77 0.25
78 0.26
79 0.2
80 0.25
81 0.26
82 0.29
83 0.28
84 0.28
85 0.26
86 0.21
87 0.2
88 0.15
89 0.15
90 0.13