Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VDF4

Protein Details
Accession K1VDF4    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
159-178EKISTKMKQRLSMKQKRSKKHydrophilic
NLS Segment(s)
PositionSequence
164-178KMKQRLSMKQKRSKK
Subcellular Location(s) mito 22.5, mito_nucl 13.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MSAFHSARPAVRRTATVAQTRAASSAHPVPPVPWASKTHTKKAPKIPNPLPAIFPQKVVLSDGSTFMQWTTAPTPQINRLTRDITNNPLWFPGMEATSRDGIMEGRIGKFHRRFAANNADPEKDSKVEDGDSPAEGRAKEKQSFQDSDLAWMSEGAKAEKISTKMKQRLSMKQKRSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.47
4 0.46
5 0.42
6 0.41
7 0.4
8 0.34
9 0.26
10 0.2
11 0.18
12 0.23
13 0.24
14 0.23
15 0.23
16 0.22
17 0.27
18 0.3
19 0.28
20 0.24
21 0.26
22 0.32
23 0.42
24 0.47
25 0.5
26 0.56
27 0.61
28 0.66
29 0.73
30 0.76
31 0.74
32 0.78
33 0.75
34 0.75
35 0.73
36 0.66
37 0.57
38 0.51
39 0.5
40 0.4
41 0.35
42 0.28
43 0.24
44 0.23
45 0.22
46 0.18
47 0.13
48 0.13
49 0.13
50 0.12
51 0.11
52 0.11
53 0.09
54 0.09
55 0.07
56 0.09
57 0.1
58 0.11
59 0.13
60 0.13
61 0.15
62 0.21
63 0.29
64 0.29
65 0.29
66 0.3
67 0.32
68 0.33
69 0.36
70 0.32
71 0.29
72 0.31
73 0.29
74 0.26
75 0.23
76 0.22
77 0.16
78 0.15
79 0.11
80 0.07
81 0.07
82 0.08
83 0.09
84 0.1
85 0.1
86 0.09
87 0.08
88 0.07
89 0.07
90 0.09
91 0.08
92 0.08
93 0.1
94 0.11
95 0.18
96 0.21
97 0.24
98 0.27
99 0.29
100 0.31
101 0.35
102 0.45
103 0.42
104 0.45
105 0.44
106 0.41
107 0.38
108 0.38
109 0.35
110 0.25
111 0.22
112 0.16
113 0.15
114 0.15
115 0.15
116 0.17
117 0.15
118 0.15
119 0.14
120 0.15
121 0.15
122 0.14
123 0.16
124 0.2
125 0.24
126 0.27
127 0.31
128 0.37
129 0.41
130 0.44
131 0.44
132 0.44
133 0.39
134 0.4
135 0.37
136 0.3
137 0.23
138 0.21
139 0.19
140 0.14
141 0.15
142 0.12
143 0.13
144 0.13
145 0.15
146 0.2
147 0.23
148 0.28
149 0.34
150 0.43
151 0.48
152 0.54
153 0.61
154 0.63
155 0.7
156 0.75
157 0.78
158 0.79