FuNGI

A0A3N4KHD1

Protein Details

Accession

A0A3N4KHD1

Localization Confidence

Low

Confidence Score

9.2

NoLS Segment(s)

Position	Sequence	Protein Nature
1-24	MFKQPDLKRHPTRRSSPVPPGPKP	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 16, cyto_nucl 11, mito 7, cyto 4

Family & Domain DBs

Amino Acid Sequences

MFKQPDLKRHPTRRSSPVPPGPKPTNVLNDDDPADQDYTSSSTLSGVSDTSHHSEYLLSRNKPAPRAPPSPPAQPVVIEISDDEDTADLPKSLKQAETETPNTKAHLEYLTAKWGPLDESQGRQAPTPPIRHHESASTSQLRAMLEPIEPPPSFHTKSLALTKRISYHELPNFIRRPTLPTSNIAGGANNPHGPNLPGPKAAGGLRLPGPHRAGGLVQPHLRDPNAPGPNRARGLIPPHPGAPNPAVSNRARPTYLPTPRHALIPRTTNSITANAHSHARATVALPRLHSSPQFRTPTTPPRYATPAIFYGSTPKAPSVSPLRPPAKPRRNTQIILSSPSEPAAKPATPQPAAQTVHSSLPSSPELPSYAWLDKTGTSIVRLHHAIRGVLAQGDEGAIRTLARELKHDWEVDEMSIYVEGFVRGALFDRVA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.85
2	0.84
3	0.84
4	0.83
5	0.82
6	0.78
7	0.79
8	0.74
9	0.7
10	0.65
11	0.61
12	0.61
13	0.54
14	0.54
15	0.47
16	0.45
17	0.43
18	0.39
19	0.34
20	0.27
21	0.25
22	0.19
23	0.16
24	0.14
25	0.14
26	0.14
27	0.13
28	0.11
29	0.11
30	0.12
31	0.12
32	0.11
33	0.08
34	0.09
35	0.1
36	0.14
37	0.17
38	0.18
39	0.17
40	0.17
41	0.19
42	0.21
43	0.29
44	0.34
45	0.32
46	0.36
47	0.42
48	0.47
49	0.5
50	0.53
51	0.53
52	0.52
53	0.57
54	0.58
55	0.61
56	0.6
57	0.62
58	0.6
59	0.53
60	0.46
61	0.4
62	0.37
63	0.32
64	0.27
65	0.19
66	0.16
67	0.17
68	0.16
69	0.15
70	0.13
71	0.08
72	0.08
73	0.09
74	0.1
75	0.07
76	0.08
77	0.1
78	0.13
79	0.14
80	0.16
81	0.16
82	0.2
83	0.25
84	0.32
85	0.36
86	0.37
87	0.39
88	0.39
89	0.38
90	0.34
91	0.29
92	0.25
93	0.2
94	0.19
95	0.19
96	0.2
97	0.25
98	0.24
99	0.23
100	0.21
101	0.2
102	0.2
103	0.17
104	0.22
105	0.18
106	0.2
107	0.24
108	0.28
109	0.28
110	0.27
111	0.29
112	0.3
113	0.34
114	0.38
115	0.37
116	0.39
117	0.45
118	0.46
119	0.44
120	0.4
121	0.39
122	0.36
123	0.4
124	0.37
125	0.32
126	0.31
127	0.32
128	0.27
129	0.23
130	0.19
131	0.14
132	0.11
133	0.12
134	0.13
135	0.15
136	0.15
137	0.15
138	0.18
139	0.23
140	0.25
141	0.24
142	0.26
143	0.23
144	0.27
145	0.35
146	0.37
147	0.34
148	0.34
149	0.35
150	0.37
151	0.37
152	0.38
153	0.31
154	0.34
155	0.35
156	0.39
157	0.39
158	0.41
159	0.42
160	0.38
161	0.37
162	0.29
163	0.3
164	0.29
165	0.33
166	0.28
167	0.28
168	0.31
169	0.29
170	0.3
171	0.25
172	0.2
173	0.15
174	0.15
175	0.14
176	0.12
177	0.11
178	0.1
179	0.11
180	0.11
181	0.14
182	0.16
183	0.16
184	0.15
185	0.15
186	0.15
187	0.17
188	0.16
189	0.16
190	0.11
191	0.12
192	0.13
193	0.15
194	0.16
195	0.17
196	0.18
197	0.16
198	0.16
199	0.14
200	0.13
201	0.14
202	0.16
203	0.16
204	0.16
205	0.17
206	0.17
207	0.18
208	0.17
209	0.14
210	0.15
211	0.21
212	0.26
213	0.26
214	0.29
215	0.31
216	0.36
217	0.36
218	0.33
219	0.25
220	0.21
221	0.27
222	0.3
223	0.3
224	0.27
225	0.27
226	0.28
227	0.27
228	0.27
229	0.22
230	0.19
231	0.16
232	0.16
233	0.19
234	0.19
235	0.25
236	0.24
237	0.25
238	0.23
239	0.22
240	0.28
241	0.33
242	0.42
243	0.39
244	0.39
245	0.43
246	0.43
247	0.48
248	0.43
249	0.37
250	0.33
251	0.36
252	0.34
253	0.35
254	0.34
255	0.31
256	0.3
257	0.29
258	0.26
259	0.21
260	0.22
261	0.17
262	0.19
263	0.17
264	0.16
265	0.12
266	0.12
267	0.11
268	0.1
269	0.14
270	0.18
271	0.19
272	0.2
273	0.21
274	0.22
275	0.23
276	0.26
277	0.26
278	0.27
279	0.35
280	0.38
281	0.37
282	0.4
283	0.45
284	0.52
285	0.53
286	0.53
287	0.45
288	0.45
289	0.5
290	0.47
291	0.42
292	0.35
293	0.31
294	0.27
295	0.26
296	0.22
297	0.22
298	0.22
299	0.22
300	0.19
301	0.17
302	0.17
303	0.17
304	0.21
305	0.23
306	0.27
307	0.31
308	0.4
309	0.44
310	0.46
311	0.55
312	0.61
313	0.63
314	0.65
315	0.66
316	0.67
317	0.7
318	0.68
319	0.66
320	0.64
321	0.57
322	0.55
323	0.51
324	0.42
325	0.35
326	0.35
327	0.3
328	0.2
329	0.21
330	0.2
331	0.18
332	0.18
333	0.23
334	0.3
335	0.3
336	0.31
337	0.31
338	0.35
339	0.36
340	0.35
341	0.34
342	0.29
343	0.31
344	0.31
345	0.28
346	0.21
347	0.23
348	0.24
349	0.21
350	0.19
351	0.17
352	0.19
353	0.18
354	0.2
355	0.21
356	0.21
357	0.21
358	0.21
359	0.21
360	0.2
361	0.21
362	0.22
363	0.18
364	0.18
365	0.2
366	0.2
367	0.24
368	0.26
369	0.25
370	0.25
371	0.27
372	0.25
373	0.23
374	0.23
375	0.18
376	0.17
377	0.16
378	0.13
379	0.1
380	0.11
381	0.09
382	0.08
383	0.08
384	0.07
385	0.07
386	0.07
387	0.11
388	0.14
389	0.15
390	0.19
391	0.22
392	0.28
393	0.33
394	0.33
395	0.3
396	0.31
397	0.32
398	0.29
399	0.26
400	0.2
401	0.16
402	0.16
403	0.15
404	0.1
405	0.09
406	0.09
407	0.07
408	0.07
409	0.07
410	0.07
411	0.09

A0A3N4KHD1

3D AlphaFold-predicted Structure Viewer