Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4L2X0

Protein Details
Accession A0A3N4L2X0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
27-60GRGVGKKRNRGEKKENNKREKKALSRTRRKSTAPBasic
NLS Segment(s)
PositionSequence
26-58RGRGVGKKRNRGEKKENNKREKKALSRTRRKST
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MYRGKQAPYVRTYCCGRQSGGPTNTRGRGVGKKRNRGEKKENNKREKKALSRTRRKSTAPRQLSKTNYLNESKPM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.44
3 0.38
4 0.39
5 0.44
6 0.48
7 0.49
8 0.47
9 0.45
10 0.47
11 0.48
12 0.43
13 0.37
14 0.31
15 0.34
16 0.39
17 0.45
18 0.49
19 0.56
20 0.62
21 0.72
22 0.75
23 0.74
24 0.76
25 0.76
26 0.79
27 0.81
28 0.85
29 0.85
30 0.86
31 0.82
32 0.81
33 0.78
34 0.76
35 0.75
36 0.76
37 0.76
38 0.79
39 0.84
40 0.84
41 0.82
42 0.79
43 0.79
44 0.8
45 0.8
46 0.78
47 0.77
48 0.74
49 0.76
50 0.75
51 0.73
52 0.69
53 0.63
54 0.59
55 0.56