Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KTI4

Protein Details
Accession A0A3N4KTI4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
65-93YPHFPRKLFYPPLQKKKPKKTITKKHKKTBasic
NLS Segment(s)
PositionSequence
78-93QKKKPKKTITKKHKKT
Subcellular Location(s) mito 8, plas 6, golg 6, E.R. 3, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSLQRGVFRFCLRALSTCRCVGVSVCRCVNWVFLYLSCLYISFFLIFFFPFLIYIYQLCLETYVYPHFPRKLFYPPLQKKKPKKTITKKHKKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.4
4 0.38
5 0.39
6 0.33
7 0.32
8 0.28
9 0.31
10 0.3
11 0.31
12 0.31
13 0.3
14 0.31
15 0.31
16 0.31
17 0.21
18 0.18
19 0.14
20 0.13
21 0.15
22 0.14
23 0.15
24 0.12
25 0.11
26 0.09
27 0.08
28 0.09
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.05
36 0.05
37 0.04
38 0.05
39 0.05
40 0.06
41 0.06
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.09
50 0.11
51 0.13
52 0.15
53 0.2
54 0.23
55 0.23
56 0.25
57 0.27
58 0.33
59 0.37
60 0.43
61 0.5
62 0.56
63 0.67
64 0.75
65 0.81
66 0.84
67 0.88
68 0.91
69 0.9
70 0.91
71 0.91
72 0.92
73 0.94