Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KVT8

Protein Details
Accession A0A3N4KVT8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
152-172GGVGPVKTVKRKKKARVAEIQHydrophilic
NLS Segment(s)
PositionSequence
83-110KRRALEAGARRRANLKRIEEGRRGERER
159-167TVKRKKKAR
Subcellular Location(s) nucl 10cyto_nucl 10, mito 8, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR028119  Snapin/Pallidin/Snn1  
Pfam View protein in Pfam  
PF14712  Snapin_Pallidin  
Amino Acid Sequences MEVDLIATQARAAVDILTAQLRHLEHEQTTLLTSLHLTCSTLSTLPNYTAIAPTLSQIPHYESKLARLKAAMAQQQRDVAELKRRALEAGARRRANLKRIEEGRRGERERDRTVLRARVMDEREAAVSEGEGGAEGGDGAAEGAGAGAGTGGGVGPVKTVKRKKKARVAEIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.09
4 0.09
5 0.09
6 0.09
7 0.12
8 0.12
9 0.15
10 0.18
11 0.2
12 0.18
13 0.21
14 0.21
15 0.18
16 0.19
17 0.16
18 0.14
19 0.11
20 0.11
21 0.1
22 0.11
23 0.1
24 0.1
25 0.09
26 0.11
27 0.12
28 0.12
29 0.12
30 0.12
31 0.13
32 0.14
33 0.14
34 0.13
35 0.12
36 0.12
37 0.12
38 0.11
39 0.09
40 0.09
41 0.11
42 0.1
43 0.1
44 0.11
45 0.14
46 0.17
47 0.17
48 0.21
49 0.18
50 0.25
51 0.32
52 0.31
53 0.28
54 0.25
55 0.25
56 0.25
57 0.3
58 0.28
59 0.24
60 0.25
61 0.25
62 0.28
63 0.26
64 0.24
65 0.2
66 0.17
67 0.22
68 0.23
69 0.23
70 0.22
71 0.22
72 0.21
73 0.2
74 0.23
75 0.23
76 0.3
77 0.37
78 0.36
79 0.36
80 0.42
81 0.44
82 0.45
83 0.45
84 0.39
85 0.39
86 0.45
87 0.51
88 0.5
89 0.52
90 0.52
91 0.52
92 0.51
93 0.49
94 0.5
95 0.51
96 0.49
97 0.49
98 0.45
99 0.43
100 0.46
101 0.46
102 0.41
103 0.36
104 0.35
105 0.37
106 0.37
107 0.32
108 0.28
109 0.23
110 0.22
111 0.2
112 0.18
113 0.11
114 0.09
115 0.08
116 0.06
117 0.05
118 0.05
119 0.04
120 0.03
121 0.03
122 0.03
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.03
141 0.03
142 0.05
143 0.08
144 0.12
145 0.22
146 0.32
147 0.42
148 0.52
149 0.63
150 0.72
151 0.8
152 0.87