Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KTW5

Protein Details
Accession A0A3N4KTW5    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
17-42WKIPWRMSSMQKYRHRQRLRRVDRLVHydrophilic
81-105FDRNAKKYRKGVHKVPKWTRVSQRVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGFLRPTQPLSGGLLWKIPWRMSSMQKYRHRQRLRRVDRLVECVDNALAKQGMTAAAVERWKMEMPTEAEMEPRDKYTLFDRNAKKYRKGVHKVPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.21
4 0.23
5 0.24
6 0.2
7 0.18
8 0.21
9 0.25
10 0.31
11 0.41
12 0.46
13 0.54
14 0.62
15 0.71
16 0.76
17 0.82
18 0.84
19 0.81
20 0.84
21 0.85
22 0.85
23 0.85
24 0.79
25 0.77
26 0.7
27 0.68
28 0.6
29 0.49
30 0.4
31 0.3
32 0.26
33 0.18
34 0.14
35 0.09
36 0.07
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.04
44 0.06
45 0.07
46 0.07
47 0.07
48 0.08
49 0.08
50 0.08
51 0.08
52 0.11
53 0.13
54 0.15
55 0.16
56 0.15
57 0.16
58 0.16
59 0.18
60 0.14
61 0.13
62 0.12
63 0.11
64 0.13
65 0.18
66 0.25
67 0.27
68 0.35
69 0.4
70 0.49
71 0.58
72 0.62
73 0.62
74 0.61
75 0.67
76 0.69
77 0.72
78 0.72
79 0.74
80 0.78
81 0.82
82 0.85
83 0.85
84 0.8
85 0.81
86 0.8
87 0.8
88 0.8
89 0.77
90 0.79