Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KEM0

Protein Details
Accession A0A3N4KEM0    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-81QAAPEQPPRKPRPRKPSSRALICPHydrophilic
NLS Segment(s)
PositionSequence
65-74PRKPRPRKPS
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MPKLLDSERPQIDYNDPTLHPLLPSYTSAASTILTAPPTPAAPTSVAAASAAPTPVPQAAPEQPPRKPRPRKPSSRALICPQKPRSASSGSNVNNKAQRTLSSPAGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.28
4 0.28
5 0.28
6 0.26
7 0.21
8 0.19
9 0.17
10 0.14
11 0.15
12 0.14
13 0.13
14 0.13
15 0.14
16 0.13
17 0.12
18 0.1
19 0.1
20 0.09
21 0.09
22 0.08
23 0.08
24 0.09
25 0.09
26 0.09
27 0.08
28 0.08
29 0.09
30 0.09
31 0.1
32 0.09
33 0.09
34 0.08
35 0.08
36 0.07
37 0.06
38 0.06
39 0.04
40 0.04
41 0.05
42 0.05
43 0.05
44 0.05
45 0.08
46 0.11
47 0.16
48 0.24
49 0.27
50 0.31
51 0.4
52 0.47
53 0.55
54 0.62
55 0.67
56 0.71
57 0.78
58 0.84
59 0.82
60 0.86
61 0.84
62 0.83
63 0.78
64 0.76
65 0.76
66 0.71
67 0.74
68 0.67
69 0.65
70 0.58
71 0.55
72 0.51
73 0.46
74 0.43
75 0.38
76 0.44
77 0.41
78 0.48
79 0.47
80 0.48
81 0.47
82 0.45
83 0.45
84 0.37
85 0.36
86 0.32
87 0.36