Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4L473

Protein Details
Accession A0A3N4L473    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MSIPQRVQKKRAEKKKMQKTAIRRARRQHydrophilic
NLS Segment(s)
PositionSequence
8-40QKKRAEKKKMQKTAIRRARRQVRYQSASRKKKR
Subcellular Location(s) mito 11, plas 8, cyto_mito 8
Family & Domain DBs
Amino Acid Sequences MSIPQRVQKKRAEKKKMQKTAIRRARRQVRYQSASRKKKRVCWGCAGGVLGVCVLCWAGGEGGKWGKPVLYFTWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.91
3 0.92
4 0.89
5 0.86
6 0.84
7 0.85
8 0.85
9 0.83
10 0.77
11 0.77
12 0.8
13 0.79
14 0.77
15 0.76
16 0.76
17 0.72
18 0.73
19 0.74
20 0.74
21 0.77
22 0.76
23 0.76
24 0.69
25 0.72
26 0.76
27 0.74
28 0.69
29 0.66
30 0.64
31 0.56
32 0.54
33 0.46
34 0.36
35 0.26
36 0.21
37 0.13
38 0.08
39 0.06
40 0.04
41 0.03
42 0.03
43 0.03
44 0.04
45 0.04
46 0.06
47 0.06
48 0.1
49 0.13
50 0.14
51 0.15
52 0.14
53 0.15
54 0.15
55 0.19