Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KG02

Protein Details
Accession A0A3N4KG02   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
145-176QPTTATRRRVPPPKRKAKPRGRKPGPKKTVSFBasic
NLS Segment(s)
PositionSequence
151-172RRRVPPPKRKAKPRGRKPGPKK
236-245RKEHPLPPRP
Subcellular Location(s) mito 13, nucl 7, cyto 6
Family & Domain DBs
Amino Acid Sequences MPARISFYRPTGQSRRQARSAHDHDVFEGLPVRRWSRDWVSVGKSQPPPPPQPELPLPKETHLLQPMSQALLQAARSSSSTTPKPVPAAPSPPGGRRFMTKRWVRIARNMEGPEPVYLAKVPDRPRRRGEEVVEVVQQQLQQQQQPTTATRRRVPPPKRKAKPRGRKPGPKKTVSFAEERLRTFPIMVPHNSDPRAPGGPNPPDTVMVDAAPVVVEEVKGEAEAEAGEEKKEEAGRKEHPLPPRPAGLPPKPVGAADLGAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.67
3 0.68
4 0.7
5 0.67
6 0.69
7 0.67
8 0.66
9 0.61
10 0.55
11 0.48
12 0.46
13 0.4
14 0.3
15 0.3
16 0.22
17 0.23
18 0.26
19 0.28
20 0.27
21 0.29
22 0.35
23 0.36
24 0.42
25 0.41
26 0.44
27 0.46
28 0.5
29 0.51
30 0.52
31 0.5
32 0.48
33 0.52
34 0.52
35 0.53
36 0.52
37 0.57
38 0.5
39 0.51
40 0.54
41 0.55
42 0.53
43 0.53
44 0.5
45 0.44
46 0.46
47 0.41
48 0.39
49 0.35
50 0.32
51 0.26
52 0.28
53 0.27
54 0.25
55 0.24
56 0.17
57 0.13
58 0.14
59 0.13
60 0.11
61 0.1
62 0.09
63 0.1
64 0.12
65 0.14
66 0.17
67 0.19
68 0.22
69 0.24
70 0.25
71 0.27
72 0.27
73 0.29
74 0.28
75 0.31
76 0.29
77 0.33
78 0.33
79 0.35
80 0.37
81 0.34
82 0.31
83 0.31
84 0.35
85 0.34
86 0.42
87 0.42
88 0.44
89 0.5
90 0.58
91 0.54
92 0.58
93 0.58
94 0.52
95 0.53
96 0.49
97 0.41
98 0.34
99 0.33
100 0.24
101 0.19
102 0.15
103 0.09
104 0.08
105 0.09
106 0.1
107 0.15
108 0.21
109 0.3
110 0.36
111 0.4
112 0.45
113 0.51
114 0.54
115 0.54
116 0.5
117 0.49
118 0.46
119 0.42
120 0.38
121 0.31
122 0.26
123 0.21
124 0.19
125 0.11
126 0.12
127 0.11
128 0.13
129 0.14
130 0.15
131 0.16
132 0.18
133 0.2
134 0.24
135 0.28
136 0.31
137 0.34
138 0.39
139 0.45
140 0.54
141 0.62
142 0.64
143 0.7
144 0.76
145 0.81
146 0.85
147 0.88
148 0.89
149 0.91
150 0.91
151 0.91
152 0.9
153 0.93
154 0.92
155 0.92
156 0.9
157 0.86
158 0.77
159 0.71
160 0.69
161 0.61
162 0.54
163 0.48
164 0.48
165 0.44
166 0.43
167 0.4
168 0.33
169 0.31
170 0.28
171 0.25
172 0.23
173 0.24
174 0.24
175 0.28
176 0.3
177 0.35
178 0.35
179 0.33
180 0.28
181 0.27
182 0.28
183 0.23
184 0.24
185 0.28
186 0.32
187 0.34
188 0.35
189 0.33
190 0.32
191 0.32
192 0.29
193 0.22
194 0.16
195 0.13
196 0.11
197 0.1
198 0.08
199 0.07
200 0.05
201 0.04
202 0.04
203 0.04
204 0.05
205 0.05
206 0.05
207 0.06
208 0.05
209 0.05
210 0.05
211 0.06
212 0.08
213 0.08
214 0.09
215 0.09
216 0.09
217 0.12
218 0.16
219 0.19
220 0.21
221 0.27
222 0.33
223 0.41
224 0.48
225 0.5
226 0.56
227 0.61
228 0.63
229 0.61
230 0.62
231 0.56
232 0.57
233 0.61
234 0.59
235 0.58
236 0.53
237 0.53
238 0.47
239 0.45
240 0.39
241 0.31