Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KYY6

Protein Details
Accession A0A3N4KYY6   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-59MQKAEERGRKKEKKTSTPPKQRKIPKENRISKSGSYHSLKGKKKKKKKVSQISAYPPLQHydrophilic
NLS Segment(s)
PositionSequence
6-48ERGRKKEKKTSTPPKQRKIPKENRISKSGSYHSLKGKKKKKKK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQKAEERGRKKEKKTSTPPKQRKIPKENRISKSGSYHSLKGKKKKKKKVSQISAYPPLQPSPLVSFFFLFFLVHPSPAIIRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.87
4 0.89
5 0.92
6 0.91
7 0.91
8 0.9
9 0.89
10 0.89
11 0.89
12 0.87
13 0.88
14 0.89
15 0.83
16 0.78
17 0.71
18 0.62
19 0.56
20 0.49
21 0.45
22 0.38
23 0.37
24 0.4
25 0.45
26 0.49
27 0.53
28 0.6
29 0.64
30 0.72
31 0.79
32 0.82
33 0.84
34 0.89
35 0.9
36 0.91
37 0.9
38 0.88
39 0.85
40 0.81
41 0.72
42 0.63
43 0.52
44 0.43
45 0.34
46 0.26
47 0.21
48 0.19
49 0.21
50 0.21
51 0.21
52 0.21
53 0.2
54 0.21
55 0.19
56 0.13
57 0.1
58 0.14
59 0.14
60 0.14
61 0.14
62 0.14